KEGG   Sus scrofa (pig): 100153986Help
Entry
100153986         CDS       T01009                                 

Gene name
CACNA2D3
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 3
Orthology
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100153986 (CACNA2D3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100153986 (CACNA2D3)
  Circulatory system
   04260 Cardiac muscle contraction
    100153986 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    100153986 (CACNA2D3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100153986 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100153986 (CACNA2D3)
   05414 Dilated cardiomyopathy (DCM)
    100153986 (CACNA2D3)
Ion channels [BR:ssc04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100153986 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 535 aa AA seqDB search
LPQAQKLADDQGPVLMTTVAMPVFSKQNETRRLGMMLWLVGTLLSLKNYGKXLPRRLGIH
GYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTG
KFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTVEEGLHD
LEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVS
APIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIF
NADHFPLWYRRAAEQIPGSFVYSIPFSTGTVNKSNVVTASTSIQLLDERKSPVVAAVGIQ
MKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEV
EGAVMHKLLTMGSFKRITLYDYQAMCRANKESSDGAHGLLDPYNAFLAAVKWIMTELVLF
LVEFNLCSWWHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIQEPSGNIACEDCSK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
ctccctcaggcacaaaagcttgccgatgatcagggcccagtcctgatgaccacggtcgct
atgcctgtgtttagtaagcagaacgaaactaggcgtctagggatgatgctctggctggtg
gggacacttttatccttgaagaattatggaaaatgactgcctaggagattagggattcac
ggctatgcctttgcaatcacaaataatggatatatcctgacgcatccagagctcagacca
ctgtatgaagaaggcaaaaagcggaggaagcctaactacagtagcgttgacctgtctgag
gtggagtgggaagaccgcgatgatgtgttacgaaatgccatggtgaatagaaagacgggg
aagttttccatggaggtgaagaagacagtggacaaagggaaacgggttttggtgatgaca
aatgactactattatacagacatcaagggtactcctttcagtttaggtgtagcgctctcc
agaggccatgggaaatacttcttccgagggaacgtaaccgttgaagaagggctacatgac
ttagaacatcccgacgtgtccttggcagacgaatggtcctactgcaacactgacctacac
ccagagcaccgtcatctgtctcaactcgaagctattaaactctatctcaaaggcaaagaa
cctctgctccaatgtgataaagaattgatacaggaagtcctttttgatgctgtggtgagt
gctcccattgaagcttattggaccagccttgccctcaacaaatctgagaattccgacaag
ggtgtggaggtagccttccttggcactcgcacgggcctctcaagaatcaacctgttcgtt
ggggctgagcagctcaccaaccaggacttcttgaaagctggagacaaggagaacatcttt
aatgcagaccatttccctctctggtaccgaagagcagctgagcagattccagggagcttc
gtctactcaatcccattcagcacaggaacagtcaacaaaagcaatgtggtgacagcaagt
acctccatccagctcctagatgagcggaaatctccagtggtggcagctgtaggcattcag
atgaaacttgaatttttccaaaggaagttctggactgccagcagacagtgtgcctctctg
gatggcaaatgctctatcagctgcgatgatgagactgtgaactgttacctcatagacaat
aatggatttattctggtgtctgaagactacacacagactggagacttttttggtgaggtg
gagggagctgtgatgcacaaattgttaacaatgggctcctttaaaagaattaccctttat
gactatcaagccatgtgcagagccaacaaggagagcagcgatggtgcccatggtctactg
gatccttataatgccttccttgctgccgtaaaatggataatgacagaacttgtcttgttc
ctggtggaatttaacctctgcagttggtggcactcagatatgacagctaaggcccagaaa
ttgaaacagaccctggagccttgtgatactgaatatccagcgtttgtctctgagcgcacc
atccaggaaccctcagggaacattgcttgtgaagactgctccaagtaa

DBGET integrated database retrieval system