KEGG   Sus scrofa (pig): 100154091Help
Entry
100154091         CDS       T01009                                 

Gene name
GPX6
Definition
glutathione peroxidase 6 (olfactory) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssc  Sus scrofa (pig)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ssc00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:ssc04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 221 aa AA seqDB search
MTPQFWASCLFSLCLVGFAQLIPKEQKMKMDCYKGVTGTIYEYGALTLNGEEYIPFKQYA
GKHVLFVNVATYUGLTAQYPELNALQEELKPFGVVVLGFPCNQFGKQEPAKNSEILLGLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSNQLFWEPMKVHDIR
WNFEKFLVGPDGVPVMRWYHRASVSTVKSDIMEYLKQFKSE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcagttctgggcctcctgtcttttctcactgtgcctggttggcttcgctcag
ctgatcccaaaggagcaaaagatgaagatggattgctacaagggggtgacaggcaccatc
tatgagtatggagccctcaccctcaatggcgaggagtacatcccgttcaagcagtacgca
ggcaaacacgtcctctttgtcaacgtggccacctattgaggcttgacagctcagtatcct
gaactgaatgcactacaagaggagctgaagccttttggtgtagttgtgttgggctttccc
tgcaaccaatttggaaaacaagaaccagcaaagaactcagagattcttttggggctcaaa
tatgtgcgtccaggtggtggctttgttcccaattttcagctctttgagaaaggggatgta
aatggagaaaaagaacagaaggtctttaccttcctgaagaactcctgccctccaacctct
gatcttttgggctcatcaaaccaactcttctgggagcccatgaaggtccatgacattcgc
tggaactttgagaagttcctggtggggcctgatggagtccctgttatgcgctggtaccac
cgggcttcagtcagcacagtcaagtcagatatcatggagtacctgaagcagttcaaaagc
gaatag

DBGET integrated database retrieval system