KEGG   Sus scrofa (pig): 100154213Help
Entry
100154213         CDS       T01009                                 

Gene name
USP40
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 40
  KO
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100154213 (USP40)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100154213 (USP40)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100154213 (USP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
15
AA seq 1332 aa AA seqDB search
MEPWSQVPARRAGAPRGILGDVVHAFHKSLTHGSAGELPTPTWRRPVVGSFFAWSFGRGG
GLGFRQVKFSFTMFGDLFEEDYSSVSNNHYGKGKKLKTKTLEPSAPREFTNLSGIRNQGG
TCYLNSLLQTLHFTPEFREALFSLGPEELGSLEDKDKPDAKVLNLWLEGFICLFVCLFWS
TGNILRKELSCLFIEIDTFIIYQIRSLFLEMTWPIPCCCLPSLLSSRTFRSCHDLRSAFL
LTVTHSIHEMRQHDVQELNRILFSALETSLVGTSGHDLINRLYHGTIVNQVVCKDCKNVS
EKQVNMQEYFSNKSLGCRLGTLSSGSLVNENCVSAGQVETAPKAESAKLRKLPPFLTVSL
LRFNFDFVKCERYKETSCYTFPLRINLKPFCEQSELDDLEYMYDLFSVIIHKGGCYGGHY
HVYIKDVDHLGNWQFQEDKSNPDVNLEDLQSEKEIDDPLMILKAILLQEESNQIPVDQLG
QKLLKKKGVSWNKKYRKQYGPLRKFLQLHSQMFQLSSDERTVSLLKDRSLQAESDFQRSD
QKTSTSESPGLNDRPSCPHWFDINDAKVQPIKEKDIEQQFQGKESAYMLFYRKSQLQRPP
EARANPRYRVPCHLLNEMDAANIELQMKRAECDSTNNSFELHLHLGPHYHFFNGALHPVV
SQTESMWDLTFDKRKTLGDLRQSIFQVILFHFLFIFDDHESDFTDNLVFLGDDLTLCETE
IADGEDIFVWNGVEVGGIQIPTGSDCEPLLLNVLHLGTSSEGEESQQLVESPHVFPSNAE
LGTVFAALSVPEGVVLINSTTSLGEESWTALAKEDLKKTFREQGLRNGSTVLIQDSNDDS
SFLTKQGKWITSTNEIDWLQVKNLCQLESEEEQVKISATLNTVVFDIRTKAIKELKLMKE
LAENSCLRPIDRKGKLLCPVPDSYTLKEAELKPGSLLGLCPGKAPTSSQLFLFFAVGSDV
QPGTEMEIIVEETVSVRGCLKIMLEKSGLSGDTWHLRKMDWCFEAGEPLCEEDATLKELM
ICSGDTLLLIEGKLPPLGFLKVPIWWYQPRGPWRHWHHQDQMDCTFAQGAPGDRQAEVSL
HYLGDIEISEDATLGELKSQALTLPNFSEFPVPSPAFLRAWTVEYKRPGRLLRVHQQQLK
EYKLGKRTEICLEPLQKEEHLGPQDVLLRTQMRLPGKRAYALPVDLVWDTARGWTAGSLR
QRVANFCSLPVEKIEIAKYFPEKFEWLPISSWNQQITKKKKKKKQDNLQGAPYYLKDGDT
IGIKNLLLEDDDDFSTDGDDAGRGQQELLALGRKQSHEALRVQSSDNVSGAEMPARPRGP
EASLSIRVGSFR
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atggagccatggagccaggttcccgcgcggcgggccggtgccccgcggggtatcctggga
gacgtagtccacgcgttccataaatccctcacgcacgggtccgcgggagagctgcccacg
ccaacatggcggcgtccggttgtggggagttttttcgcttggagttttggccggggcggg
ggtctgggctttaggcaggtaaaatttagtttcacaatgtttggggacctatttgaagag
gactattccagtgtgtcaaataatcattatggaaaagggaagaaattaaagaccaaaact
ttggagccatctgctcctagagaattcaccaatttaagtggaatcagaaatcagggtgga
acctgttacctcaattcccttcttcagactcttcatttcacacctgaattcagagaagct
ttgttttctcttggcccagaggagctcggttcattagaggataaggataagcctgatgca
aaggtattaaatctatggcttgaagggtttatttgtttgtttgtttgtttgttttggagt
acaggaaatattttaaggaaagaattaagttgcttattcatagaaatcgatacttttatt
atttaccaaatacgatctttatttttagaaatgacttggcctataccctgttgttgtctt
ccctcactgctctcctcccgcaccttccgttcgtgccatgacctccgttcggcctttctt
ctcacagtcactcacagcatccatgaaatgaggcaacatgatgtgcaggaactgaatcga
attctctttagtgctttggaaacttctttagttgggacctccggccatgacctcatcaat
cgtctgtatcacggaaccattgttaaccaggttgtttgtaaagactgtaagaatgtcagt
gaaaagcaggtgaatatgcaagagtattttagtaataagtccctaggttgcaggttagga
actctgagttctggttctttagtgaatgagaactgtgtgtctgctggtcaagtggagact
gcacccaaggcggagtcggccaaattacgtaagctgcctccctttctcactgtttcatta
ctaagatttaattttgattttgtgaagtgtgaacgatacaaggaaactagctgctataca
ttccctctccggatcaacctcaagcctttttgtgaacagagtgaattagatgacttggaa
tatatgtatgacctcttctcggttattatacacaagggtggttgctatggaggacactat
catgtgtatattaaagacgttgatcatttgggaaactggcagtttcaagaggacaaaagt
aacccagatgtgaatttagaagatcttcagagtgaaaaagagattgatgatccattgatg
attctaaaagcaatcttattacaggaggagagtaatcaaattcctgttgatcagctgggc
cagaaactcttgaaaaagaaaggagtgtcttggaataagaagtacagaaaacagtatgga
ccactgcgaaagttcttacagcttcactctcagatgtttcagctcagttcagatgaaaga
acagtgagtctgttgaaggaccgttctctccaggctgagtctgatttccaaaggagtgat
caaaagacaagtacttcagagtccccaggtttaaacgatagaccctcctgtccccactgg
tttgatataaatgacgccaaagtccagccaatcaaggaaaaggatattgaacagcaattt
cagggtaaagaaagtgcctacatgttgttttatcggaaatcccagttgcagagaccccct
gaagctcgagctaacccaagatacagggttccatgtcatttgctgaatgaaatggatgca
gccaacattgaactacaaatgaaaagggcagaatgtgattctacaaacaatagttttgaa
ttgcatctccacctcggcccccattatcatttcttcaatggggctctgcacccagtagtc
tcacaaacagaaagcatgtgggatttgacctttgataaaagaaaaactttaggagatctt
cgacaatcaatatttcaggtaatattgtttcacttcctcttcatttttgatgatcatgag
agtgatttcactgataatctcgtcttcctaggagatgacctgacactgtgtgaaactgag
attgctgatggggaagacatctttgtctggaatggggtggaggttggtggaatccagatt
ccaaccggtagtgactgtgaacctctgcttttaaatgttcttcatctgggcacaagcagc
gaaggagaggagagtcagcagttggtggaatctccgcatgtctttccatctaacgcggaa
ctaggcactgtgttcgcagccttgtcagtcccagaaggggtcgtcttaatcaacagcacc
acatctctaggtgaggagagctggaccgcccttgccaaggaagacttgaagaagactttc
agagaacaaggtctcagaaatggaagcacagttttaattcaggattctaatgatgatagc
agttttttgaccaaacaagggaaatggatcactagtacgaatgagattgactggctccaa
gttaaaaatttatgccaattagaatctgaagaggagcaagttaaaatatcagcaactctt
aacacagtggtgtttgatattcgaactaaagccataaaggaattaaaattaatgaaggaa
ctagctgaaaacagctgtttgaggcctattgacagaaaggggaagcttctttgtccagtg
ccagacagttacactttgaaggaagcagaattgaagccggggagtttattgggcctctgt
cctggaaaagcaccgacatcttctcagctattcctgttttttgctgtcgggagtgatgtt
cagcctgggacagagatggagatcatagtggaagaaacagtatctgtaagaggttgttta
aagataatgctggagaaatctggcctgtcaggagacacatggcatttacgaaaaatggat
tggtgctttgaagctggggagcctttatgtgaagaagatgcaacactgaaagagcttatg
atatgttctggagataccttgcttttaattgaaggaaaacttcctcctctgggcttcctg
aaggtgcccatctggtggtaccagccacggggtccctggcgtcactggcatcatcaggac
cagatggactgtacctttgctcaaggtgctcctggtgacaggcaggcggaagtttctctc
cactacttgggagacattgaaatctcagaagatgccaccctgggggagctgaagtctcag
gccctgaccttgccgaacttctcggagtttcccgtcccttccccagccttcctcagagcc
tggacggtggagtacaagcggcccggcagactcttacgcgtccaccagcagcagctcaag
gaatataagttggggaagagaactgagatctgcttagagccccttcagaaagaagaacac
ttgggcccccaggatgtgctgctgaggacacagatgcgcctccctggcaagagggcatat
gctctgcccgtggacttagtgtgggacacggcccgaggctggacggctggctccctgagg
cagcgagtagccaatttctgttctcttcctgtggagaaaatcgaaattgccaaatacttt
cctgaaaagtttgagtggcttccaatatctagctggaaccagcaaattactaagaaaaag
aagaagaaaaagcaagataatttgcagggggcaccttattatttgaaagatggagatact
attggtattaagaacctcctgctcgaagacgacgacgatttcagcacagacggagatgac
gccgggagaggacaacaggaactgctcgctctggggaggaagcaaagccacgaagccctt
cgcgtgcagagcagcgacaacgtctctggtgcagagatgcctgcccggccccgtggacca
gaagcttctctctccatccgcgtggggagtttccgatag

DBGET integrated database retrieval system