KEGG   Sus scrofa (pig): 100154213Help
Entry
100154213         CDS       T01009                                 

Gene name
USP40
Definition
ubiquitin specific peptidase 40
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100154213 (USP40)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100154213 (USP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 1219 aa AA seqDB search
RVKFSFTMFGDLFEEDYSSVSNNHYGKGKKLKTKTLEPSAPREFTNLSGIRNQGGTCYLN
SLLQTLHFTPEFREALFSLGPEELGSLEDKDKPDAKVLNLWLEGFICLFVCLFWSTGNIL
RKELSCLFIEIDTFIIYQIRSLFLEMTWPIPCCCLPSLLSSRTFRSCHDLRSAFLLTVTH
SIHEMRQHDVQELNRILFSALETSLVGTSGHDLINRLYHGTIVNQVVCKDCKNVSEKQSA
KLRKLPPFLTVSLLRFNFDFVKCERYKETSCYTFPLRINLKPFCEQSELDDLEYMYDLFS
VIIHKGGCYGGHYHVYIKDVDHLGNWQFQEDKSNPDVNLEDLQSEKEIDDPLMILKAILL
QESNQIPVDQLGQKLLKKKGVSWNKKYRKQYGPLRKFLQLHSQMFQLSSDERTVSLLKDR
SLQAESDFQRSDQKTSTSESPGLNDRPSCPHWFDINDAKVQPIKEKDIEQQFQGKESAYM
LFYRKSQLQRPPEARANPRYRVPCHLLNEMDAANIELQMKRAECDSTNNSFELHLHLGPH
YHFFNGALHPVVSQTESMWDLTFDKRKTLGDLRQSIFQVILFHFLFISDFTDNLVFLGDD
LTLCETEIADGEDIFVWNGVEVGGIQIPTGSDCEPLLLNVLHLGTSSEGEESQQLVESPH
VFPSNAELGTVFAALSVPEGVVLINSTTSLGEESWTALAKEDLKKTFREQGLRNGSTVLI
QDSNDDSSFLTKQGKWITSTNEIDWLQVKNLCQLESEEEQVKISATLNTVVFDIRTKAIK
ELKLMKELAENSCLRPIDRKGKLLCPVPDSYTLKEAELKPGSLLGLCPGKAPTSSQLFLF
FAVGSDVQPGTEMEIIVEETVSVRGCLKIMLEKSGLSGDTWHLRKMDWCFEAGEPLCEED
ATLKELMICSGDTLLLIEGKLPPLGFLKVPIWWYQPRGPWRHWHHQDQMDCTFAQGAPGD
RQAEVSLHYLGDIEISEDATLGELKSQALTLPNFSEFPVPSPAFLRAWTVEYKRPGRLLR
VHQQQLKEYKLGKRTEICLEPLQKEEHLGPQDVLLRTQMRLPGKRAYALPVDLVWDTARG
WTAGSLRQRVANFCSLPVEKIEIAKYFPEKFEWLPISSWNQQITKKKKKKKQDNLQGAPY
YLKDGDTIGIKNLLLEDDDDFSTDGDDAGRGQQELLALGRKQSHEALRVQSSDNVSGAEM
PARPRGPEASLSIRVGSFR
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
agggtaaaatttagtttcacaatgtttggggacctatttgaagaggactattccagtgtg
tcaaataatcattatggaaaagggaagaaattaaagaccaaaactttggagccatctgct
cctagagaattcaccaatttaagtggaatcagaaatcagggtggaacctgttacctcaat
tcccttcttcagactcttcatttcacacctgaattcagagaagctttgttttctcttggc
ccagaggagctcggttcattagaggataaggataagcctgatgcaaaggtattaaatcta
tggcttgaagggtttatttgtttgtttgtttgtttgttttggagtacaggaaatatttta
aggaaagaattaagttgcttattcatagaaatcgatacttttattatttaccaaatacga
tctttatttttagaaatgacttggcctataccctgttgttgtcttccctcactgctctcc
tcccgcaccttccgttcgtgccatgacctccgttcggcctttcttctcacagtcactcac
agcatccatgaaatgaggcaacatgatgtgcaggaactgaatcgaattctctttagtgct
ttggaaacttctttagttgggacctccggccatgacctcatcaatcgtctgtatcacgga
accattgttaaccaggttgtttgtaaagactgtaagaatgtcagtgaaaagcagtcggcc
aaattacgtaagctgcctccctttctcactgtttcattactaagatttaattttgatttt
gtgaagtgtgaacgatacaaggaaactagctgctatacattccctctccggatcaacctc
aagcctttttgtgaacagagtgaattagatgacttggaatatatgtatgacctcttctcg
gttattatacacaagggtggttgctatggaggacactatcatgtgtatattaaagacgtt
gatcatttgggaaactggcagtttcaagaggacaaaagtaacccagatgtgaatttagaa
gatcttcagagtgaaaaagagattgatgatccattgatgattctaaaagcaatcttatta
caggagagtaatcaaattcctgttgatcagctgggccagaaactcttgaaaaagaaagga
gtgtcttggaataagaagtacagaaaacagtatggaccactgcgaaagttcttacagctt
cactctcagatgtttcagctcagttcagatgaaagaacagtgagtctgttgaaggaccgt
tctctccaggctgagtctgatttccaaaggagtgatcaaaagacaagtacttcagagtcc
ccaggtttaaacgatagaccctcctgtccccactggtttgatataaatgacgccaaagtc
cagccaatcaaggaaaaggatattgaacagcaatttcagggtaaagaaagtgcctacatg
ttgttttatcggaaatcccagttgcagagaccccctgaagctcgagctaacccaagatac
agggttccatgtcatttgctgaatgaaatggatgcagccaacattgaactacaaatgaaa
agggcagaatgtgattctacaaacaatagttttgaattgcatctccacctcggcccccat
tatcatttcttcaatggggctctgcacccagtagtctcacaaacagaaagcatgtgggat
ttgacctttgataaaagaaaaactttaggagatcttcgacaatcaatatttcaggtaata
ttgtttcacttcctcttcattagtgatttcactgataatctcgtcttcctaggagatgac
ctgacactgtgtgaaactgagattgctgatggggaagacatctttgtctggaatggggtg
gaggttggtggaatccagattccaaccggtagtgactgtgaacctctgcttttaaatgtt
cttcatctgggcacaagcagcgaaggagaggagagtcagcagttggtggaatctccgcat
gtctttccatctaacgcggaactaggcactgtgttcgcagccttgtcagtcccagaaggg
gtcgtcttaatcaacagcaccacatctctaggtgaggagagctggaccgcccttgccaag
gaagacttgaagaagactttcagagaacaaggtctcagaaatggaagcacagttttaatt
caggattctaatgatgatagcagttttttgaccaaacaagggaaatggatcactagtacg
aatgagattgactggctccaagttaaaaatttatgccaattagaatctgaagaggagcaa
gttaaaatatcagcaactcttaacacagtggtgtttgatattcgaactaaagccataaag
gaattaaaattaatgaaggaactagctgaaaacagctgtttgaggcctattgacagaaag
gggaagcttctttgtccagtgccagacagttacactttgaaggaagcagaattgaagccg
gggagtttattgggcctctgtcctggaaaagcaccgacatcttctcagctattcctgttt
tttgctgtcgggagtgatgttcagcctgggacagagatggagatcatagtggaagaaaca
gtatctgtaagaggttgtttaaagataatgctggagaaatctggcctgtcaggagacaca
tggcatttacgaaaaatggattggtgctttgaagctggggagcctttatgtgaagaagat
gcaacactgaaagagcttatgatatgttctggagataccttgcttttaattgaaggaaaa
cttcctcctctgggcttcctgaaggtgcccatctggtggtaccagccacggggtccctgg
cgtcactggcatcatcaggaccagatggactgtacctttgctcaaggtgctcctggtgac
aggcaggcggaagtttctctccactacttgggagacattgaaatctcagaagatgccacc
ctgggggagctgaagtctcaggccctgaccttgccgaacttctcggagtttcccgtccct
tccccagccttcctcagagcctggacggtggagtacaagcggcccggcagactcttacgc
gtccaccagcagcagctcaaggaatataagttggggaagagaactgagatctgcttagag
ccccttcagaaagaagaacacttgggcccccaggatgtgctgctgaggacacagatgcgc
ctccctggcaagagggcatatgctctgcccgtggacttagtgtgggacacggcccgaggc
tggacggctggctccctgaggcagcgagtagccaatttctgttctcttcctgtggagaaa
atcgaaattgccaaatactttcctgaaaagtttgagtggcttccaatatctagctggaac
cagcaaattactaagaaaaagaagaagaaaaagcaagataatttgcagggggcaccttat
tatttgaaagatggagatactattggtattaagaacctcctgctcgaagacgacgacgat
ttcagcacagacggagatgacgccgggagaggacaacaggaactgctcgctctggggagg
aagcaaagccacgaagcccttcgcgtgcagagcagcgacaacgtctctggtgcagagatg
cctgcccggccccgtggaccagaagcttctctctccatccgcgtggggagtttccgatag

  All links  
No link information was found.   
DBGET integrated database retrieval system