KEGG   Sus scrofa (pig): 100154828Help
Entry
100154828         CDS       T01009                                 

Gene name
ACSS1
Definition
acyl-CoA synthetase short-chain family member 1
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ssc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ssc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ssc00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 672 aa AA seqDB search
MAARCLGCGVGRLLGGLRGVGARGPGVPRLWSSAPAAPPGFYQERIALAAREPAAFWGPL
AKDVLVWDTPYHTVSDCDFRSGKIGWFLGGQLNVSVNCLDQHVQKSPESVALIWERDEPG
TAVRITYRELLETTCRLANTLKRHGVCRGDRVAIYMPVSPMAVAAMLACARIGAVHTVIF
AGFSAGSLAGRINDAKCKVLITFNQGLRGGRVVELKRIVDEAVKLCPSIQHVLVAHRTDN
KVPMGNLDIPLEQEMAKEEPVCAPESMGSEDTLFLLYTSGSTGKPKGLVHTQAGYLLYAA
LTHRLVFDYRPGDIFGCMADIGWITGHSYVVYGPLCNGATSVLFESTPVYPDAGRYWETV
QRLKINQFYGAPTAFRLLLKYSDSWVKKYDRSSLRTLGSVGEPINHEAWEWLHQVVGDGR
CTLVDTWWQTETGGICISPRPSEEGANILPCMAMRPLFGIVPVLMDEKGKVLEGGDVSGA
LCLSQAWPGMARTIYGDHQRFIDAYFKAFPGYYFTGDGAYRTEEGYYQITGRMDDVINIS
GHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFIVLKDGTGDVDVVVKELRSVV
ADKIAKYAVPDQVLVVKRLPKTRSGKVMRRLLRKIVTGQAQDLGDTTTLEDPSVISEILS
AYQEYKDKRGAL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccgttgcttgggctgcggcgtcgggcggctcctgggcggccttcgcggggtg
ggggctcggggccccggggtcccccgtctctggagcagcgcccccgccgcgccgcccggc
ttttatcaggagcggatcgcgctggccgcgcgcgagccggccgccttttgggggccgctg
gcgaaggacgtgctcgtgtgggacaccccctaccacacggtgagcgactgcgacttccgc
agcggcaagatcggctggttcctgggaggccagttaaatgtgtccgtcaactgcctggat
cagcatgttcagaagtccccagagagcgttgctttgatctgggagcgggacgagcctgga
actgcggtgaggatcacctacagggagctgctggagaccacatgccgcctggccaacaca
ctcaaaaggcatggagtctgccgaggggaccgtgtggccatctacatgcccgtctctcct
atggccgtggctgcaatgctggcctgcgccaggatcggagccgtccacaccgtcatcttt
gctggcttcagtgcggggtccttggctgggaggatcaatgatgccaagtgcaaagtgctc
atcaccttcaaccaaggactccggggagggcgcgtggtggagctgaagaggatcgtggac
gaagccgtgaagctctgccccagcatccagcatgtcctggtagctcacaggacagacaac
aaggttcccatggggaacctggacatccccctcgagcaggagatggccaaggaggagccc
gtgtgcgccccggagagcatgggcagcgaggacacgctcttcctgctgtacacctcgggg
agcaccgggaagcccaagggactcgtccacacccaggcaggctacctgctctatgccgcc
ctgacacaccggctagtgtttgactaccggccaggcgacatctttggctgcatggccgac
atcggctggatcacaggacacagctatgtggtgtatgggcccctctgcaatggagcgacc
agcgtcctttttgagagcaccccagtttatcctgatgctggtcggtactgggaaacagtg
cagaggttgaagatcaaccagttctatggtgccccgacggccttccggctgctactcaaa
tacagtgactcctgggtgaagaagtacgaccgctcctccctgcggaccctgggctcagtg
ggagagccaatcaaccacgaggcctgggagtggctgcatcaagtggtgggggacggccgg
tgcacgctggtggacacctggtggcagacagaaacgggtggcatctgcatctctccacgg
ccctcggaggagggggcgaacatcctgccctgcatggcgatgaggcccctgtttggcatt
gtccctgttctcatggacgagaaggggaaggtcctggaaggtggagatgtgtccggggct
ctgtgcctgtcccaagcctggccaggcatggcccggaccatctacggagaccaccagcgg
ttcatagacgcctacttcaaggccttcccaggttactacttcactggggacggggcgtac
cgaaccgaagagggctactatcagataacagggcggatggacgatgtcatcaacatcagt
ggccaccggctggggacagcagagattgaggatgccatggccgaccatcccgcggtgccg
gagactgccgtcatcggctacccccatgacatcaagggagaagctgcgtttgcctttatc
gtgttgaaagatggcacaggggacgtggacgtggtggtgaaagagctccggtcggtggtg
gctgacaagattgccaagtatgcggtgcccgaccaggttctggtggtgaaacgtctgcca
aaaactaggtctggaaaagtcatgcggcggctcctgaggaagattgtcactggccaagct
caggacctgggggacaccaccaccctggaggaccccagcgttatctcggagatactcagt
gcctaccaggagtacaaggacaagagaggggctttgtga

DBGET integrated database retrieval system