KEGG   Sus scrofa (pig): 100154935Help
Entry
100154935         CDS       T01009                                 

Definition
POM121-like protein 2-like
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100154935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1017 aa AA seqDB search
MGSFLGKAGPSPSSPAAGRPDLSERPVNRRPAQSLHQIHRVQHVHRAHPAPRHRPARRPP
NWDPKRPATWVVNEAWRRFPMKRSQNSIMGPLPSDWWESYFKRSIWSLRHPRAMWSPVTI
KIAPPELTVPPSASPAEVINSGGSSLSEKPPDPCAKETVLRALGECRKGKVRLEQPLFPE
SLVSEQRILETRPSAFKPLTKNGVLTSFVPRPGPLKRSLGPRSSDHSFNKRPSCSSRGSL
VSTHTGGPLSSKRNAITSSYSSSRDCFEPWKRSIPNVSLQIPEWPVKKKGKCHHTLSLVP
LVEDESPETPGSSGEQNQIPLLLSSPGYLLSPTPPPQLGYEVPEDLALGKKAGLQWSNKA
GEDKTEVTTDSVPETWSCIQPSLSLAQPSAETASTQGTNPQLESLNKMQKPPGPLTFSQP
TGEAISVAHSHLTASLLAPLGCSKSEPLSGTSSDSKPTAAFILLTPVAPTSSVTDTTWPP
STSQAAVPGDSPAFTQSALFGLMSSPAPHLPASTPLVATSADHMSKSILGLPPNSEIGGS
LYSRISDTAAASSTLSILTPTFTPIFGSIKTLKTVPMIAPFSFKQKSPPPPPASTHLFHG
LVKATSVVMSTTPASTSKDSSFKPPLDFGMVNVTSTVSNIYSIPSTCHTFLLGTACTLSA
SFSPATGFISLPHQRPTIPIVHTVTIFSQVLPSAVQISPTRSTANFRAMGSSLSTSALVT
TNQPVLSSRISNSTSAFTVPLGSSSRPYFPLSLGANSQPAFETAYGQKKGAPQPALGPSF
GNSFIFGNSTVASSVPIPTPALPSFSNTTHSAFGGMAPSASTFHIPATLRSDFGSTPVGF
PFDQANTSGFGVVTPTHQSGACNAVFGSTAPRPFAFGGLVTPMDCGESGISVTTSGVSSN
SGAFSIGVVPSGTTPYGKGCSQDNQSAPFALGRASISARKTMFGSPSMAPFAQSTTVPGS
VKAGSSLGCEMPSSPAQGSPGRGAFRLAAPSFSIGAKSKTPKNREKGHFRRHHAHRK
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtttcctgggcaaggcgggaccctcgccatcgtccccagcagcgggccgccca
gacttgtcggagaggccggtgaaccgccggccagctcagtctcttcaccaaatccaccgg
gttcagcacgtccatcgtgcccaccctgccccacggcacagacctgcgaggaggccaccg
aactgggatcctaaacgtcccgccacgtgggtggtcaatgaggcttggaggcgctttccc
atgaagaggtcccagaattccatcatggggcctcttccttcagactggtgggaaagttac
ttcaagcggagtatttggtctcttcggcaccctagggcaatgtggagcccagtgaccatc
aagatcgctcctccagagctgacagtgcctccctccgcttccccagcagaggtaatcaac
tctggagggtcctcactctctgagaagcccccagacccctgtgcaaaggagacagtgctg
agggccctcggagagtgcaggaaagggaaagtgaggttggaacaaccactgtttccagag
agcttggtcagtgagcaaaggattctagagactagaccatctgcatttaagcctctgaca
aaaaatggagtcctcacttcttttgtgcccaggcctgggcctctgaagagaagtctcggc
cctaggagctcagatcacagcttcaataagaggcccagttgttcctctaggggctccttg
gtcagcacacacacgggtggcccccttagctccaaaagaaatgctattacaagttcttac
agctcttctagagattgctttgagccttggaagagaagtattcccaatgtgtcactccag
ataccagagtggccagtgaaaaagaaagggaaatgtcatcacaccctctctctggtccca
ctggtagaagacgaatccccagaaacacctggcagctctggggagcaaaatcagattcca
ctgcttctatctagtcctgggtacctgctgtccccgactccacctccccagcttggttat
gaagtccctgaagacctggccttagggaagaaagctggactccaatggagcaacaaagcc
ggagaggacaagactgaggtcaccacagactctgtccctgagacttggtcttgtattcag
ccttctctgtctcttgcccagccttctgcagaaacagcttcaacccagggcaccaatcct
cagttggaaagcttaaataaaatgcagaagcctccaggcccactgaccttctcacaacct
acaggagaggcaatcagtgtggcccattcacatctgacagcaagcctgctggccccactt
gggtgctcgaagtcagagcccctttcaggcacctcctcagactcaaaacccacagctgct
ttcattcttctgacccctgttgctcccacatcatcagtcactgacaccacatggccacct
tcaacctctcaagctgctgtgcccggagactcacctgcctttacacaaagtgctttgttt
ggactaatgagtagtccagctccccatcttcctgcatctacacctcttgttgcaacttct
gctgaccacatgtcaaaatctattttagggctcccacccaatagtgagattggaggctcc
ttatattccagaatttcagatacagccgcagcatcttcaactctgagtatcttaacaccc
accttcacgcctatctttggcagcataaagacacttaaaactgtgcccatgatagcacct
ttctctttcaagcagaagtctcctccacctcctcctgcttctacccatctcttccatggc
ctagtcaaggctacctctgtagtcatgtccaccaccccagcctccacatccaaagactct
tcttttaagccacctttggattttggcatggtgaatgttaccagtaccgtgagcaacatt
tactccatcccttccacttgccacactttccttcttgggactgcttgtaccttgtcggcc
agcttctccccagccacaggcttcatttctctaccacaccagcgtcctaccattcctatt
gtccacacagtcaccatctttagtcaggttcttcccagtgctgtccagatatcccctaca
aggagtactgctaattttagggctatgggcagctctctgtcaacctcagccctagtaacc
accaaccagccagtactgtcatctaggatctccaattctacctcagcattcacagttccc
ttagggtcaagctcaagaccatatttcccactatccctgggagccaattcccagcctgca
tttgagactgcatatgggcaaaagaaaggagctccccaaccagcccttggcccaagcttc
ggtaactctttcatttttggaaactcaaccgtggcatcctcagtcccgataccaactcca
gccctgccatccttcagcaataccacgcactcagcctttgggggtatggcaccatcagcc
tccacctttcacatccctgccaccctccggtcagactttggcagcactccggtaggtttt
ccctttgatcaagctaatacaagtggttttggagttgtcactccaacccaccagagtggg
gcttgtaatgcagtgtttggtagcacagccccacgcccttttgcctttggaggattagtg
acccctatggactgtggagagtctgggatcagtgtgactacctctggtgtgagctccaac
tctggagcattcagcattggagtagtgccaagtgggaccacaccctatggaaaaggctgc
agccaagacaaccagagcgcaccttttgccttggggagggccagcatttctgcaagaaaa
actatgtttggaagcccctcaatggccccctttgctcagagcaccactgtacctgggtca
gtcaaggcaggcagtagccttggctgtgagatgccctcttcacctgcccagggctctcct
gggagaggagctttcagattggcagctccttcattttccattggcgcaaaatccaaaacc
ccaaagaatagggagaaaggacatttccgaaggcatcatgcccacaggaaataa

DBGET integrated database retrieval system