KEGG   Sus scrofa (pig): 100154962Help
Entry
100154962         CDS       T01009                                 

Gene name
PTPRR
Definition
(RefSeq) LOW QUALITY PROTEIN: receptor-type tyrosine-protein phosphatase R
  KO
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100154962 (PTPRR)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100154962 (PTPRR)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    100154962 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
5
AA seq 683 aa AA seqDB search
MHLPQTLSRLAPESFPWQPCSARHLCSVPTGSLKKWATCGREASTPSGCLSRNNDHFLAV
HQKKSGKPAFVYHHSQDLEKSLDIAPQKIYRHSYHSSSGAQISKQHPIVNSAFPRPAYDP
SLNLLAMAGQDLEVENLPIPAANVIVVTLQMDVNRLNITLLRIFRQGVAAALGLLPQQVH
INRLIEKKNSVELFVSPVNRKAGISDALPSEEVLRSLNINVLHQSLSQFGITDVSPEKNV
LQGQHEADKIWSKEGFYAVVIFLSIFVIIVTCLMILYRLKEKFQLSLRQDKEKNQEIHLS
PIALQPVPSEAKIGNSMVQPEQAPKILNVVVDPQGQYTPEIKASTSVCPSPFRMKPIGLQ
ERRGSNVSLTLDMSSLGXVEPFVATPTPRXKVAMEYLQSASRILTRSQLRDAVASSHLLQ
SEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINANYIRG
YNGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGK
VEVLVINVKECDNYTVRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEED
RLASAGRGPVIVHCSAGIGRTGCFIATSIGCRQLREEGVVDALSIVCQLRVDRGGMVQTS
EQYEFVHHALCLYESRLAAETVQ
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcatttaccgcagacactcagccggctggcgcctgaaagcttcccctggcaaccctgc
tcagcaagacacctgtgctctgttcccacaggcagcctgaaaaaatgggcaacctgcggc
cgggaagcgtcaactcccagcgggtgcctttcaagaaataatgatcactttttggcagtt
catcagaagaagagtgggaagccagcattcgtttatcatcattcgcaagatcttgagaag
agtctggatatagctccacaaaagatatataggcacagctaccattcctcttctggcgct
cagataagcaaacagcacccaattgttaattcagcatttcctagacctgcatatgaccca
tctctcaatctgttggccatggctggtcaagaccttgaagtggaaaaccttccaatccca
gcagcaaatgtaattgtggtgacactgcagatggatgtaaacaggctgaacataaccttg
cttcggatattccgccaaggagtggccgcagcattaggactcttaccccagcaagtgcac
atcaatcgccttattgaaaagaagaacagtgttgaactatttgtgtctcccgtaaatcga
aaagcagggatctctgatgccctgccgtctgaggaggtgcttcggtcactgaatatcaat
gttttgcatcaaagtttatcccagtttggaattacagacgtctcccctgagaaaaatgtt
ttacaaggacagcatgaagcggacaaaatctggagcaaagaaggattttatgctgttgtc
atttttctcagcatctttgttattatagtaacgtgtttgatgattctttatagattaaaa
gaaaaatttcagctttccctgagacaagataaggagaaaaatcaggagatccacctgtcg
cccattgcattacagccagtaccgtccgaggcgaagataggcaacagcatggtccagcct
gagcaggccccgaagatactaaatgtggtcgtggaccctcaaggccaatacacccctgag
atcaaagcctccacctctgtctgcccttctcctttcagaatgaagcccataggacttcag
gagagacgagggtccaacgtatctcttacactcgacatgagtagcttggganctgttgaa
ccctttgtggccaccccaacccctcggngaaaggtagcaatggagtatctgcagtcagcc
agccgaattctcacaaggtcacagctgagggacgccgtggcaagttcgcatttactccaa
agtgaattcatggaaataccaatgaactttgtggatcccaaagaaattgatattccacgc
catggaactaaaaatcgttataagactattttgccaaatcccctcagccgagtatgttta
agaccaaaaaatgtaacggattctttgagcacctacattaatgctaattatattaggggc
tacaatggcaaagagaaagcattcatcgccacccagggtcccatgatcaacacagtgaat
gatttctggcagatggtttggcaggaagacagtcctgtgattgttatgatcacaaagctc
aaagagaaaaacgagaaatgtgtgctttactggccagaaaaaagaggaatatatgggaaa
gttgaggttctggttatcaacgtcaaagaatgtgataactatactgttcgaaatcttgtc
ttaaagcaaggaagtcacacccaacatgtgaagcattactggtacacttcatggccggat
cacaagactccggacagtgcccagccccttctacagctcatgctggatgtggaagaagac
agactcgcctccgcgggccgagggcctgtgattgtccactgcagtgcagggataggcagg
accgggtgttttattgctacatccattggctgtcgacagttgagagaggaaggagttgtg
gacgcattgagcatcgtctgccagcttcgtgtggacaggggtggaatggtccaaaccagt
gagcagtatgaatttgtgcatcatgctctgtgcctgtatgagagcagacttgcagcagaa
actgtccagtga

DBGET integrated database retrieval system