KEGG   Sus scrofa (pig): 100154993Help
Entry
100154993         CDS       T01009                                 

Gene name
ACACB
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ssc  Sus scrofa (pig)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ssc01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ssc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ssc00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ssc00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:ssc04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 2454 aa AA seqDB search
MTLLLFLSCLIISCLTFSWLKVWGEMTDSKPVTKSQLKAPSLLGREPLPASDSSPEPLQE
NDNSSSLPKTSSQAEPASHKGPKDTGRQRTSRPPPQQDPQGNPLFSSDAPAAPQANVTRA
AGLEAPNASGLALPARPQGQRAKTLSRQDKKQEHIKRQLMTNFILGSFDDNSSDEDSGAG
LFRDSSRKGSRASLGTLGLEAAPTTGEAETPVTTIRPSMSGFHLARREQKKLDLHRDFTV
ASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDL
KANAEYIKMADQYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKLPELL
HKHEIAFLGPPSEAMWALGDKIASTIVAQTLKIPTLPWSGSGLTVEWTEDSLQQGQRISV
PQCIYEEGCVKDVDEGLEAAEKIGYPLMIKASEGGGGKGIRKAETAEDFPILFRQVQSEI
PGSPVFLMKLAQHAHHLEVQILADQYGNAVSLFGRDCSIQRRHQKIIEEAPATIATPAVF
EFMEQCAVRLAKTVGYVSTGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQ
LQIAMGVPLHRLKDIRLLYGESPWGVTPIAFETPTNPPVARGHVIAARITSENPDEGFKP
SSGTVQELNFRSSKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKEL
SIRGDFRTTVEYLTNLLETESFQNNDIDTGWLDNLIAEKVQAEKPDIMLGVVCGALNVAD
SMFRTCMTEFLHSLERGQVLPADSLLNIVDVELIYGGVKYILKVARQSPTMFVLIMNNCH
IEIDAHRLNDGGLLLSYNGNSYTTYMKEEVNSYRLTIGNKTCVFEKENDPTILRAPSAGK
LMQYTVEDGGHVEAGGSFAEIEVMKMIMTLNVQESGRVKYVKRPGAVLETGCVVARLELD
DPSKVHPAEPFTGELPHQQTLPILGEKLHQVFHSVLENLTNIMNGYCLPEPIFSMKLKDW
VQKLLMTLRHPSLPLLELQEIMTSVAGRIPPPVEKAVRRVMAQYASNITSVLCQFPSQQI
ATILDCHAATLQRKADREVFFMNTQSIVQLVQKYRSGTRGYMKAVVLDLLRKYLLVEHHF
QQAHYDKCVINLREQLKPDMSRVLDCIFSHAQVAKKNQLVIMLIDELCGPDPSLSDELTA
ILNELTQLSKSEHCKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCPENLK
KLILSETTIFDVLPTFFYHANNVVCMASLEVYVRRGYIAYELTSLQHRQLPDGSCVVEFQ
FMLPSSHPNRMAVPISVTNPELLRHSTELFMDSGFSPQSQRMGAMVAFQRFEDFIRNFDE
VISCFANVPTDTPLFSKARTSLYSEDDSKSLREEPVHILNVAIRYADHHEDEQLVPIFRT
FVQSKKNILMDHGLRRITFLLVQEKEFPKFFTFRARDKFAEDRIYRHLEPALAFQLELSR
LRNFDVTAMPCANHKMHLYLGAARVQEGAEVTDHRFFIRVIIRHSDLITKEASFEYLQNE
GERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPTKIEESVRSMVMRYGSRLWK
LRVLQAEVKINIRQTTTDSAVPIRLFITNESGYYLDISLYKEVTDPRSGNIMFHSFGNKQ
GPQHGMLINTPYVTKDLLQAKRFQAQSLGTTYVYDFPEMFRQALFKMWGSPDKYPKDILT
YTELVLDPQGQLVEMNRLPGGNEVGMVAFKMRLKTLEYPEGRDIILIGNDITFCIGSFGP
GEDLLYLRASELARAEGIPKIYLAANSGARIGLAEEIKHMFQVAWVDPRDPYKGFKYLYL
TPQDYTRISSLNSVHCKHIEEEGESRYIITDIIGKEEGLGVENLKGSGMIAGETSLDYDE
IVTISLVTCRALGIGAYLVRLGQRVIQVENSHIILTGAMALNKVLGREVYTSNNQLGGVQ
IMHSNGVSHVTVPDDFEGVCTILEWLSYMPKDNHSPVPIITPTDPVDREIEFQPSRSPYD
PRWLLAGRPHPTLKGSWQSGFFDQGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVETRTV
ELAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAIRDFSREKLPLIIFANWRGFSGGM
KDMYDQVLKFGAYIVDGFRQYKQPILIYIPPYGELRGGSWAVMDTSINPLCIEIYADKES
RASILEPEGTVEIKFRKKDLVKTMRRIDPIYKKLVEQLGSSELSNKDRKELEGQLKARED
LLLPMYHQVAVHFADLHDKPGRMLEKGAICDILDWKTTRTFLYWRLRRLLLEDQVKQEIL
QACSDLSHVHVQSMLRRWFVETEGAVKAYLWDNNQTVVQWLEKHWQVGEGLRSTIRENIK
YLKRDSALKTIRGLVQDNPDVATDSLIYVSQFISPAERAQVIHLLSTMDGPAST
NT seq 7365 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgctcctttttctatcctgcctgattatctcttgcctgaccttttcctggtta
aaagtctggggtgaaatgacggactccaagccagtcaccaaaagtcaactgaaagctccc
tccctcctgggtcgggagcctctcccagcctcagacagctccccagagcctctgcaggaa
aatgacaacagcagctctctgccaaagacctccagccaggctgagcctgcctcccacaaa
ggccccaaagacaccggcaggcagagaacttcccggccacccccacagcaggacccccaa
ggaaaccccctcttctcctctgatgcccccgcagcaccccaagccaacgtgactcgggcc
gcaggcctggaggccccaaatgccagtggcctggccttgccagccagaccccagggccag
agagccaaaactctctccagacaagacaagaagcaagagcacatcaagaggcagctgatg
accaacttcatcctgggctctttcgacgacaactcctctgatgaggactctggtgctggc
ttgttccgagactcctcccggaagggcagccgggccagcctggggaccctgggcctggag
gctgccccgaccacaggcgaggctgagacccctgtcaccacgataaggcccagcatgtcg
gggttccatctggcaagaagagaacagaagaagctggacctgcacagggacttcactgtg
gcttcccccgccgagtttgtcacgcgctttgggggggatcgggtcattgagaaggtgctc
atcgccaacaatggcattgctgctgtgaagtgcatgcgctccatccgcaggtgggcctac
gagatgttccgaaatgagcgggccatccggtttgtagtcatggtaacccctgaggacctc
aaggccaatgcagagtatatcaagatggcagatcagtatgtccctgtcccaggagggccc
aacaacaacaattatgccaatgtggagctaattgtggacattgccaagaggatccctgtg
caggcagtgtgggctggctggggccatgcttctgaaaaccccaaacttccggagctcctg
cacaagcacgagattgctttcttaggtcctcccagtgaggccatgtgggccctgggagac
aagattgcctccaccatcgtggcccagaccctgaagatcccaacgttgccctggagcgga
agtggtctgacagtggagtggacagaagacagcctacagcagggacaaaggatcagtgtc
ccacagtgcatttatgaggaaggttgcgtgaaagatgtagatgagggcttggaggcagca
gaaaaaattggttatcccttgatgatcaaagcttctgaaggtggtggagggaaaggaata
cggaaggccgagaccgccgaggacttcccaatccttttcagacaggtgcagagcgagatc
cctggctccccggtctttctcatgaagctggcccagcacgcccatcacctggaggtccag
atcctcgccgaccagtatgggaatgccgtgtccctgtttgggcgtgactgttccatccag
cggaggcatcagaagatcatagaggaggcgccagccaccatcgccacgccagccgtgttt
gagttcatggagcagtgtgctgtgcgcctggccaagactgtgggctacgtgagcacaggg
acagttgaatacctctacagccaggatggcagcttccacttcttggagctgaatccccgc
ctgcaggtggaacatccctgcacggaaatgatcgctgatgtcaacctgccggctgcccag
ctacagatcgccatgggtgtgccgctgcaccggctgaaggatatccggcttctgtatgga
gagtccccgtggggggtgacgcctattgcttttgaaacccctaccaaccctcccgtggcc
cgaggccacgtcatcgcagctagaattaccagcgaaaacccagatgaggggtttaagccg
agctccggaacagtccaggaattgaatttccgcagcagcaagaatgtgtggggttatttc
agcgtggcggctgctggtggattacatgaatttgctgattcccagtttgggcactgcttc
tcctggggagagaaccgggaagaggctatttcgaacatggtggtggctttgaaggaattg
tccatccggggcgacttcaggaccacggtggaatatcttaccaacctcctggagacggag
agcttccagaacaatgacattgacaccggctggctggataacctcatcgccgagaaagtg
caggccgagaagccagatatcatgctcggggtggtgtgtggagccttgaacgtggccgac
tcaatgttcagaacctgcatgacggagttcttacactcgctggaaaggggccaagtcctc
cctgcagactctctgctgaacattgtggatgtggaattaatctacggaggcgtgaagtac
attcttaaggtggcccgacagtccccgaccatgtttgtcctcatcatgaacaactgtcac
atcgagatcgacgcccatcggctgaacgacggggggctgctgctgtcctataatgggaac
agctacaccacctacatgaaagaagaggtcaacagttaccgcctcaccatcggcaacaag
acctgtgtgtttgagaaggagaatgatcccaccatcctgagagccccttctgctgggaag
ctgatgcagtacacggtggaggacgggggccacgtcgaggctgggggcagcttcgctgag
atagaggtgatgaagatgatcatgaccctgaacgtgcaggaaagtggccgggtgaagtat
gtcaagcgcccaggggctgtattggaaacaggctgtgtggtggccaggctggagctcgat
gacccttccaaagtgcacccagctgagccattcacaggcgagcttccccaccagcagacg
ctgcccatccttggagagaagctgcaccaggttttccacagcgtcctggaaaacctgact
aacatcatgaatggctactgtctgccggagcctatttttagcatgaagctgaaggactgg
gtgcagaagctcctgatgactctccggcacccgtcgctgccactgctggagctgcaggag
atcatgacgagcgtggcgggccgcatccccccacccgtggagaaggcagtccgcagggtg
atggcccaatatgccagcaacatcacctcggtgctatgtcagttccccagccagcagata
gccaccatcttggactgtcacgcggccaccctgcagcggaaggccgaccgggaggtcttc
ttcatgaacacccagagcattgtgcagctggtccaaaaataccgcagcgggacccgcggc
tatatgaaggcggtggtgttggatctcctgcgaaaatatttactggttgagcaccatttc
caacaagcccattatgacaagtgtgtgataaacctcagggagcagctgaagccggacatg
tcccgggtgttggactgcatcttctcccacgcgcaggtggccaagaagaaccagctggtg
atcatgttgatcgatgagctctgtggtccagacccttctctgtcagacgagttgaccgcc
atcctcaacgagctgactcagctgagcaagagcgagcactgcaaggtggccctcagagcc
aggcaggtcctgatcgcctcccacctcccctcctacgagctgaggcacaaccaggtggag
tctattttcctgtcggccatcgacatgtacggccaccagttctgccctgaaaacctcaag
aaactaatactgtcagaaacgaccatattcgacgtcctgcccactttcttctatcatgct
aacaatgtcgtctgcatggcatccttggaggtttatgtgcggaggggctacattgcctat
gagttaaccagcctgcagcaccggcagctcccggatggctcctgcgtggtggaattccag
ttcatgctgccctcctcccacccaaaccggatggccgtgcccatcagtgtcaccaaccct
gaactgctgagacacagcacagagctcttcatggacagtggcttctccccccagtcccag
cggatgggggccatggtcgccttccagagatttgaggatttcatcaggaactttgatgag
gtcatctcctgcttcgccaatgtgcccacagacacccccctcttcagcaaggcccgcact
tccctgtactccgaggacgacagcaagagcctccgagaagagccagtccacatcctgaat
gtggccattcggtatgcggaccaccatgaggatgagcagctggtgcccattttccggaca
tttgtgcagtccaagaaaaacatcctcatggatcatggactccgaagaatcacattcctg
cttgtccaagagaaagaatttcctaagtttttcacattcagagcaagagacaagtttgca
gaggatcgcatttaccgtcacttggagccggccctggccttccagctggagctcagtcgg
ttgcgaaactttgacgtgaccgccatgccctgtgccaaccacaagatgcacctgtacctg
ggcgccgccagagtgcaggagggcgccgaggtgacggaccacaggttcttcatccgcgtc
atcatcaggcactcggacctgatcaccaaggaggcctccttcgagtacctgcagaatgag
ggtgagcggctgctcctggaggccatggacgagctggaggtggcgttcaacaacaccagc
gtgcgcaccgactgcaaccacatcttcctcaacttcgtgcccactgtcatcatggacccc
accaagatcgaggagtcggtacgctccatggtcatgcgctacggcagccggttgtggaaa
ctccgagtgctccaggctgaggtcaagatcaacatccgccagaccactactgacagtgct
gttcccatccgcctgttcatcaccaacgagtcaggctactatctggacatcagcctctac
aaagaagtgaccgaccccagatctggaaacatcatgtttcactcctttggcaacaaacaa
gggccccagcacgggatgctcatcaacactccctacgtcaccaaggatctgcttcaggcc
aagcggttccaggcccagtccctgggtaccacctatgtgtatgacttcccggaaatgttc
aggcaggctctttttaaaatgtggggttcaccagacaagtaccccaaagacatcctgaca
tataccgaactggtgctggaccctcagggccaactggtggagatgaaccgacttcctgga
ggaaacgaggtgggcatggtggcctttaaaatgaggcttaagaccctcgagtacccagaa
gggcgggacatcatcctcatcggcaatgacatcaccttctgcatcgggtcctttgggccc
ggggaagacctcctgtacctgcgggcatctgagctggcccgggcagagggcatccccaaa
atctaccttgccgccaacagtggggcccgaattggcctcgcagaggagatcaaacacatg
ttccaggtggcgtgggtggacccgcgagacccctacaagggatttaaatacctgtacctg
accccccaagactacaccagaatcagctccctgaactccgtccattgtaaacacatcgag
gaggaaggagaatccaggtacatcatcacggatatcatcgggaaggaggaaggcctgggc
gtggagaatctgaagggctcaggcatgattgctggagagacctccctggattacgacgag
attgtcaccatcagcctggtgacctgccgagccctggggatcggggcctacctggtgagg
ctgggccagcgagtgatccaggtggagaattcccacatcatcctgacaggggccatggct
ctcaacaaggtcctgggcagagaggtctacacatctaacaaccagctgggcggcgtgcag
atcatgcattccaatggtgtgtcccatgtcactgtgccggacgactttgagggcgtttgt
actatcctggagtggctctcctatatgccaaaggacaatcacagcccagtcccgatcatc
acacccactgaccccgtggacagagaaattgaattccaaccatcccgatcgccctatgac
ccccggtggctgcttgcaggaagacctcacccaactctaaagggatcctggcagagtgga
ttcttcgaccaaggcagtttcaaggaaatcatggcgccctgggcccagaccgtggtgaca
ggacgagccaggctaggggggatccccgtcggagtgatcgctgtggagactcggacagtg
gagctggctgtgcctgcagaccctgccaacttggattctgaggccaagataatccagcag
gcgggccaggtgtggtttccagactcagcctacaagacggcccaggccatcagggatttc
agccgggaaaagttgcccctgataatctttgccaactggagggggttctccgggggcatg
aaagacatgtatgaccaggtgctgaagtttggagcctacatcgtggatggcttccggcag
tacaaacagcccatcctgatctacatcccaccctacggagagctccggggaggctcctgg
gcagtcatggacaccagcattaacccgctgtgcatagaaatatatgcagacaaagagagc
agggcaagtattctggagccagagggaacagtggagattaaattccggaagaaagatctg
gtaaagaccatgagaagaattgacccaatttacaagaagctcgtggaacagctaggatcg
tcagagctctccaacaaggaccgaaaggagctggaaggccagctgaaggcccgggaggac
ctgctgctgcccatgtaccaccaggtggcggtgcatttcgcggacctccacgacaagccc
ggcaggatgctggagaagggcgccatctgtgatatcctggattggaagactacccgcacc
ttcctgtactggcgcctacgccgcctgctgctggaggaccaggttaagcaggagatcctg
caggcctgcagcgatctcagccacgtgcatgtccagtccatgctgcgccgctggtttgtg
gagacggagggggctgtcaaggcctacctgtgggacaacaaccagacggtggtgcagtgg
ctggagaagcactggcaggtgggggagggactgcgctccaccatccgagagaacatcaaa
tacttgaagcgagactccgccctcaagaccatcagaggcctggttcaagataaccccgac
gtggccacagactccctgatatatgtaagccagtttatcagcccagccgagcgtgcccag
gtcattcacctcttgtccaccatggacggcccggcctccacctga

DBGET integrated database retrieval system