KEGG   Sus scrofa (pig): 100154993Help
Entry
100154993         CDS       T01009                                 

Gene name
ACACB
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ssc  Sus scrofa (pig)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100154993 (ACACB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100154993 (ACACB)
   00640 Propanoate metabolism
    100154993 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100154993 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100154993 (ACACB)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100154993 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100154993 (ACACB)
Enzymes [BR:ssc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100154993 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100154993 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 2454 aa AA seqDB search
MTLLLFLSCLIISCLTFSWLKVWGEMTDSKPVTKSQLKAPSLLGREPLPASDSSPEPLQE
NDNSSSLPKTSSQAEPASHKGPKDTGRQRTSRPPPQQDPQGNPLFSSDAPAAPQANVTRA
AGLEAPNASGLALPARPQGQRAKTLSRQDKKQEHIKRQLMTNFILGSFDDNSSDEDSGAG
LFRDSSRKGSRASLGTLGLEAAPTTGEAETPVTTIRPSMSGFHLARREQKKLDLHRDFTV
ASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDL
KANAEYIKMADQYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKLPELL
HKHEIAFLGPPSEAMWALGDKIASTIVAQTLKIPTLPWSGSGLTVEWTEDSLQQGQRISV
PQCIYEEGCVKDVDEGLEAAEKIGYPLMIKASEGGGGKGIRKAETAEDFPILFRQVQSEI
PGSPVFLMKLAQHAHHLEVQILADQYGNAVSLFGRDCSIQRRHQKIIEEAPATIATPAVF
EFMEQCAVRLAKTVGYVSTGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQ
LQIAMGVPLHRLKDIRLLYGESPWGVTPIAFETPTNPPVARGHVIAARITSENPDEGFKP
SSGTVQELNFRSSKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKEL
SIRGDFRTTVEYLTNLLETESFQNNDIDTGWLDNLIAEKVQAEKPDIMLGVVCGALNVAD
SMFRTCMTEFLHSLERGQVLPADSLLNIVDVELIYGGVKYILKVARQSPTMFVLIMNNCH
IEIDAHRLNDGGLLLSYNGNSYTTYMKEEVNSYRLTIGNKTCVFEKENDPTILRAPSAGK
LMQYTVEDGGHVEAGGSFAEIEVMKMIMTLNVQESGRVKYVKRPGAVLETGCVVARLELD
DPSKVHPAEPFTGELPHQQTLPILGEKLHQVFHSVLENLTNIMNGYCLPEPIFSMKLKDW
VQKLLMTLRHPSLPLLELQEIMTSVAGRIPPPVEKAVRRVMAQYASNITSVLCQFPSQQI
ATILDCHAATLQRKADREVFFMNTQSIVQLVQKYRSGTRGYMKAVVLDLLRKYLLVEHHF
QQAHYDKCVINLREQLKPDMSRVLDCIFSHAQVAKKNQLVIMLIDELCGPDPSLSDELTA
ILNELTQLSKSEHCKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCPENLK
KLILSETTIFDVLPTFFYHANNVVCMASLEVYVRRGYIAYELTSLQHRQLPDGSCVVEFQ
FMLPSSHPNRMAVPISVTNPELLRHSTELFMDSGFSPQSQRMGAMVAFQRFEDFIRNFDE
VISCFANVPTDTPLFSKARTSLYSEDDSKSLREEPVHILNVAIRYADHHEDEQLVPIFRT
FVQSKKNILMDHGLRRITFLLVQEKEFPKFFTFRARDKFAEDRIYRHLEPALAFQLELSR
LRNFDVTAMPCANHKMHLYLGAARVQEGAEVTDHRFFIRVIIRHSDLITKEASFEYLQNE
GERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPTKIEESVRSMVMRYGSRLWK
LRVLQAEVKINIRQTTTDSAVPIRLFITNESGYYLDISLYKEVTDPRSGNIMFHSFGNKQ
GPQHGMLINTPYVTKDLLQAKRFQAQSLGTTYVYDFPEMFRQALFKMWGSPDKYPKDILT
YTELVLDPQGQLVEMNRLPGGNEVGMVAFKMRLKTLEYPEGRDIILIGNDITFCIGSFGP
GEDLLYLRASELARAEGIPKIYLAANSGARIGLAEEIKHMFQVAWVDPRDPYKGFKYLYL
TPQDYTRISSLNSVHCKHIEEEGESRYIITDIIGKEEGLGVENLKGSGMIAGETSLDYDE
IVTISLVTCRALGIGAYLVRLGQRVIQVENSHIILTGAMALNKVLGREVYTSNNQLGGVQ
IMHSNGVSHVTVPDDFEGVCTILEWLSYMPKDNHSPVPIITPTDPVDREIEFQPSRSPYD
PRWLLAGRPHPTLKGSWQSGFFDQGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVETRTV
ELAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAIRDFSREKLPLIIFANWRGFSGGM
KDMYDQVLKFGAYIVDGFRQYKQPILIYIPPYGELRGGSWAVMDTSINPLCIEIYADKES
RASILEPEGTVEIKFRKKDLVKTMRRIDPIYKKLVEQLGSSELSNKDRKELEGQLKARED
LLLPMYHQVAVHFADLHDKPGRMLEKGAICDILDWKTTRTFLYWRLRRLLLEDQVKQEIL
QACSDLSHVHVQSMLRRWFVETEGAVKAYLWDNNQTVVQWLEKHWQVGEGLRSTIRENIK
YLKRDSALKTIRGLVQDNPDVATDSLIYVSQFISPAERAQVIHLLSTMDGPAST
NT seq 7365 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgctcctttttctatcctgcctgattatctcttgcctgaccttttcctggtta
aaagtctggggtgaaatgacggactccaagccagtcaccaaaagtcaactgaaagctccc
tccctcctgggtcgggagcctctcccagcctcagacagctccccagagcctctgcaggaa
aatgacaacagcagctctctgccaaagacctccagccaggctgagcctgcctcccacaaa
ggccccaaagacaccggcaggcagagaacttcccggccacccccacagcaggacccccaa
ggaaaccccctcttctcctctgatgcccccgcagcaccccaagccaacgtgactcgggcc
gcaggcctggaggccccaaatgccagtggcctggccttgccagccagaccccagggccag
agagccaaaactctctccagacaagacaagaagcaagagcacatcaagaggcagctgatg
accaacttcatcctgggctctttcgacgacaactcctctgatgaggactctggtgctggc
ttgttccgagactcctcccggaagggcagccgggccagcctggggaccctgggcctggag
gctgccccgaccacaggcgaggctgagacccctgtcaccacgataaggcccagcatgtcg
gggttccatctggcaagaagagaacagaagaagctggacctgcacagggacttcactgtg
gcttcccccgccgagtttgtcacgcgctttgggggggatcgggtcattgagaaggtgctc
atcgccaacaatggcattgctgctgtgaagtgcatgcgctccatccgcaggtgggcctac
gagatgttccgaaatgagcgggccatccggtttgtagtcatggtaacccctgaggacctc
aaggccaatgcagagtatatcaagatggcagatcagtatgtccctgtcccaggagggccc
aacaacaacaattatgccaatgtggagctaattgtggacattgccaagaggatccctgtg
caggcagtgtgggctggctggggccatgcttctgaaaaccccaaacttccggagctcctg
cacaagcacgagattgctttcttaggtcctcccagtgaggccatgtgggccctgggagac
aagattgcctccaccatcgtggcccagaccctgaagatcccaacgttgccctggagcgga
agtggtctgacagtggagtggacagaagacagcctacagcagggacaaaggatcagtgtc
ccacagtgcatttatgaggaaggttgcgtgaaagatgtagatgagggcttggaggcagca
gaaaaaattggttatcccttgatgatcaaagcttctgaaggtggtggagggaaaggaata
cggaaggccgagaccgccgaggacttcccaatccttttcagacaggtgcagagcgagatc
cctggctccccggtctttctcatgaagctggcccagcacgcccatcacctggaggtccag
atcctcgccgaccagtatgggaatgccgtgtccctgtttgggcgtgactgttccatccag
cggaggcatcagaagatcatagaggaggcgccagccaccatcgccacgccagccgtgttt
gagttcatggagcagtgtgctgtgcgcctggccaagactgtgggctacgtgagcacaggg
acagttgaatacctctacagccaggatggcagcttccacttcttggagctgaatccccgc
ctgcaggtggaacatccctgcacggaaatgatcgctgatgtcaacctgccggctgcccag
ctacagatcgccatgggtgtgccgctgcaccggctgaaggatatccggcttctgtatgga
gagtccccgtggggggtgacgcctattgcttttgaaacccctaccaaccctcccgtggcc
cgaggccacgtcatcgcagctagaattaccagcgaaaacccagatgaggggtttaagccg
agctccggaacagtccaggaattgaatttccgcagcagcaagaatgtgtggggttatttc
agcgtggcggctgctggtggattacatgaatttgctgattcccagtttgggcactgcttc
tcctggggagagaaccgggaagaggctatttcgaacatggtggtggctttgaaggaattg
tccatccggggcgacttcaggaccacggtggaatatcttaccaacctcctggagacggag
agcttccagaacaatgacattgacaccggctggctggataacctcatcgccgagaaagtg
caggccgagaagccagatatcatgctcggggtggtgtgtggagccttgaacgtggccgac
tcaatgttcagaacctgcatgacggagttcttacactcgctggaaaggggccaagtcctc
cctgcagactctctgctgaacattgtggatgtggaattaatctacggaggcgtgaagtac
attcttaaggtggcccgacagtccccgaccatgtttgtcctcatcatgaacaactgtcac
atcgagatcgacgcccatcggctgaacgacggggggctgctgctgtcctataatgggaac
agctacaccacctacatgaaagaagaggtcaacagttaccgcctcaccatcggcaacaag
acctgtgtgtttgagaaggagaatgatcccaccatcctgagagccccttctgctgggaag
ctgatgcagtacacggtggaggacgggggccacgtcgaggctgggggcagcttcgctgag
atagaggtgatgaagatgatcatgaccctgaacgtgcaggaaagtggccgggtgaagtat
gtcaagcgcccaggggctgtattggaaacaggctgtgtggtggccaggctggagctcgat
gacccttccaaagtgcacccagctgagccattcacaggcgagcttccccaccagcagacg
ctgcccatccttggagagaagctgcaccaggttttccacagcgtcctggaaaacctgact
aacatcatgaatggctactgtctgccggagcctatttttagcatgaagctgaaggactgg
gtgcagaagctcctgatgactctccggcacccgtcgctgccactgctggagctgcaggag
atcatgacgagcgtggcgggccgcatccccccacccgtggagaaggcagtccgcagggtg
atggcccaatatgccagcaacatcacctcggtgctatgtcagttccccagccagcagata
gccaccatcttggactgtcacgcggccaccctgcagcggaaggccgaccgggaggtcttc
ttcatgaacacccagagcattgtgcagctggtccaaaaataccgcagcgggacccgcggc
tatatgaaggcggtggtgttggatctcctgcgaaaatatttactggttgagcaccatttc
caacaagcccattatgacaagtgtgtgataaacctcagggagcagctgaagccggacatg
tcccgggtgttggactgcatcttctcccacgcgcaggtggccaagaagaaccagctggtg
atcatgttgatcgatgagctctgtggtccagacccttctctgtcagacgagttgaccgcc
atcctcaacgagctgactcagctgagcaagagcgagcactgcaaggtggccctcagagcc
aggcaggtcctgatcgcctcccacctcccctcctacgagctgaggcacaaccaggtggag
tctattttcctgtcggccatcgacatgtacggccaccagttctgccctgaaaacctcaag
aaactaatactgtcagaaacgaccatattcgacgtcctgcccactttcttctatcatgct
aacaatgtcgtctgcatggcatccttggaggtttatgtgcggaggggctacattgcctat
gagttaaccagcctgcagcaccggcagctcccggatggctcctgcgtggtggaattccag
ttcatgctgccctcctcccacccaaaccggatggccgtgcccatcagtgtcaccaaccct
gaactgctgagacacagcacagagctcttcatggacagtggcttctccccccagtcccag
cggatgggggccatggtcgccttccagagatttgaggatttcatcaggaactttgatgag
gtcatctcctgcttcgccaatgtgcccacagacacccccctcttcagcaaggcccgcact
tccctgtactccgaggacgacagcaagagcctccgagaagagccagtccacatcctgaat
gtggccattcggtatgcggaccaccatgaggatgagcagctggtgcccattttccggaca
tttgtgcagtccaagaaaaacatcctcatggatcatggactccgaagaatcacattcctg
cttgtccaagagaaagaatttcctaagtttttcacattcagagcaagagacaagtttgca
gaggatcgcatttaccgtcacttggagccggccctggccttccagctggagctcagtcgg
ttgcgaaactttgacgtgaccgccatgccctgtgccaaccacaagatgcacctgtacctg
ggcgccgccagagtgcaggagggcgccgaggtgacggaccacaggttcttcatccgcgtc
atcatcaggcactcggacctgatcaccaaggaggcctccttcgagtacctgcagaatgag
ggtgagcggctgctcctggaggccatggacgagctggaggtggcgttcaacaacaccagc
gtgcgcaccgactgcaaccacatcttcctcaacttcgtgcccactgtcatcatggacccc
accaagatcgaggagtcggtacgctccatggtcatgcgctacggcagccggttgtggaaa
ctccgagtgctccaggctgaggtcaagatcaacatccgccagaccactactgacagtgct
gttcccatccgcctgttcatcaccaacgagtcaggctactatctggacatcagcctctac
aaagaagtgaccgaccccagatctggaaacatcatgtttcactcctttggcaacaaacaa
gggccccagcacgggatgctcatcaacactccctacgtcaccaaggatctgcttcaggcc
aagcggttccaggcccagtccctgggtaccacctatgtgtatgacttcccggaaatgttc
aggcaggctctttttaaaatgtggggttcaccagacaagtaccccaaagacatcctgaca
tataccgaactggtgctggaccctcagggccaactggtggagatgaaccgacttcctgga
ggaaacgaggtgggcatggtggcctttaaaatgaggcttaagaccctcgagtacccagaa
gggcgggacatcatcctcatcggcaatgacatcaccttctgcatcgggtcctttgggccc
ggggaagacctcctgtacctgcgggcatctgagctggcccgggcagagggcatccccaaa
atctaccttgccgccaacagtggggcccgaattggcctcgcagaggagatcaaacacatg
ttccaggtggcgtgggtggacccgcgagacccctacaagggatttaaatacctgtacctg
accccccaagactacaccagaatcagctccctgaactccgtccattgtaaacacatcgag
gaggaaggagaatccaggtacatcatcacggatatcatcgggaaggaggaaggcctgggc
gtggagaatctgaagggctcaggcatgattgctggagagacctccctggattacgacgag
attgtcaccatcagcctggtgacctgccgagccctggggatcggggcctacctggtgagg
ctgggccagcgagtgatccaggtggagaattcccacatcatcctgacaggggccatggct
ctcaacaaggtcctgggcagagaggtctacacatctaacaaccagctgggcggcgtgcag
atcatgcattccaatggtgtgtcccatgtcactgtgccggacgactttgagggcgtttgt
actatcctggagtggctctcctatatgccaaaggacaatcacagcccagtcccgatcatc
acacccactgaccccgtggacagagaaattgaattccaaccatcccgatcgccctatgac
ccccggtggctgcttgcaggaagacctcacccaactctaaagggatcctggcagagtgga
ttcttcgaccaaggcagtttcaaggaaatcatggcgccctgggcccagaccgtggtgaca
ggacgagccaggctaggggggatccccgtcggagtgatcgctgtggagactcggacagtg
gagctggctgtgcctgcagaccctgccaacttggattctgaggccaagataatccagcag
gcgggccaggtgtggtttccagactcagcctacaagacggcccaggccatcagggatttc
agccgggaaaagttgcccctgataatctttgccaactggagggggttctccgggggcatg
aaagacatgtatgaccaggtgctgaagtttggagcctacatcgtggatggcttccggcag
tacaaacagcccatcctgatctacatcccaccctacggagagctccggggaggctcctgg
gcagtcatggacaccagcattaacccgctgtgcatagaaatatatgcagacaaagagagc
agggcaagtattctggagccagagggaacagtggagattaaattccggaagaaagatctg
gtaaagaccatgagaagaattgacccaatttacaagaagctcgtggaacagctaggatcg
tcagagctctccaacaaggaccgaaaggagctggaaggccagctgaaggcccgggaggac
ctgctgctgcccatgtaccaccaggtggcggtgcatttcgcggacctccacgacaagccc
ggcaggatgctggagaagggcgccatctgtgatatcctggattggaagactacccgcacc
ttcctgtactggcgcctacgccgcctgctgctggaggaccaggttaagcaggagatcctg
caggcctgcagcgatctcagccacgtgcatgtccagtccatgctgcgccgctggtttgtg
gagacggagggggctgtcaaggcctacctgtgggacaacaaccagacggtggtgcagtgg
ctggagaagcactggcaggtgggggagggactgcgctccaccatccgagagaacatcaaa
tacttgaagcgagactccgccctcaagaccatcagaggcctggttcaagataaccccgac
gtggccacagactccctgatatatgtaagccagtttatcagcccagccgagcgtgcccag
gtcattcacctcttgtccaccatggacggcccggcctccacctga

DBGET integrated database retrieval system