KEGG   Sus scrofa (pig): 100155108Help
Entry
100155108         CDS       T01009                                 

Gene name
THBS3
Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
ssc  Sus scrofa (pig)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100155108 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100155108 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100155108 (THBS3)
  Cell communication
   04510 Focal adhesion
    100155108 (THBS3)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100155108 (THBS3)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100155108 (THBS3)
  Exosomal proteins of colorectal cancer cells
   100155108 (THBS3)
  Exosomal proteins of bladder cancer cells
   100155108 (THBS3)
Heparan sulfate/heparin binding proteins [BR:ssc00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100155108 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 956 aa AA seqDB search
METQELRGALALLFLCTFASASQDLQVIDLLTLGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSPALQLYVDCKLGDQHAGLPALAPIPPAEVNGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHSAVASALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPTPCFRGVDCMEVYEYPGYCC
GPCPPGFQGNGTHCTDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTRVSGVGIDY
ARASKQVCNDIDECNDGDNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSHGCFPARTCHS
PAHSPCHVHAHCLFERNGAVSCLCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGAIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcttcctttgcactttcgcatct
gccagtcaggacctgcaggtgatcgacctgctgactctgggcgagtcccggcagatggta
gctgtggcggagaagattcggacagccctgctcaccgctggggacatctacctcttgtcc
accttccgtctgccccccaagcagggtggtgtcctctttggcctctactctcgccaagac
aacacacgatggctggaggcctctgttgtgggcaagatcaacaaagtgctggtgcggtac
cagcgggaggatggcaaagtccacgcggtgaacctacagcaagcaggcctggcagatggg
cgcacacacaccgctctcctgcgactccgaggcccgtccagacccagccctgccctgcag
ctgtacgtggactgcaaactgggcgaccagcatgctggccttccggcactggcccctatt
cctccagcagaggtcaatgggctggagattaggactggacagaaggcttatttgaggatg
cagggcttcgtggaatcaatgaaaatgattctgggcgggtccatggcccgggtcggagcc
ctgagtgagtgtccgttccagggggatgagtccatccacagtgcagtggccagtgcactc
cactccatcctaggggaacagaccaaagcgctggtcacccaactcaccctcttcaaccag
atcctggtagagctgcgggatgatatccgagaccaggtgaaagaaatgtccctgatccga
aacaccatcatggagtgtcaggtgtgcggcttccacgaacagcgctcccactgcagcccc
accccctgcttccgaggcgtggactgcatggaggtgtacgagtacccaggctactgctgt
gggccctgcccccccggcttccaggggaacggcacccactgcactgacatcaatgagtgc
gctcacgccgacccttgtttcccgggctccagttgcatcaacaccatgcccggcttccac
tgtgaggcctgtccccgaggctacaaaggcacacgggtgtctggcgtgggcattgactat
gcccgggccagcaagcaggtctgcaacgatatcgatgaatgcaatgatggggacaacggc
ggctgtgacccaaactccatctgcaccaatactgtgggctctttcaagtgtggtccctgt
cgcttgggcttcctgggcaaccagagccatggctgcttcccggcccggacctgccacagc
ccagcccacagcccctgccatgtccacgcgcactgtctctttgaacgcaatggtgcagtg
tcctgcttgtgcaacgtgggctgggccgggaacgggaacgtgtgcgggcctgacacagac
attgatggctacccggaccaggcgctgccctgcatggacaacaacaaacactgcaagcag
gacaactgccttctgacacccaactctgggcaggaagatgcagataacgatggcgtgggg
gaccagtgtgatgatgatgctgatggggacgggatcaagaatgttgaggacaattgccgg
ctgttccccaacaaggaccagcaaaactcagatacagattcatttggtgatgcctgtgac
aactgccccaacgttcccaacaatgaccagaaggacacagatggcaatggggaaggggat
gcctgtgacaacgacgtggatggggatggcatccccaatggactggacaattgccctaaa
gtccccaaccccctgcagacagacagggatgaagacggggtgggagatgcttgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagtgacctggtgggggatgtc
tgtgacaccaatgaagacagcgatggggatggacatcaggacaccaaggacaattgcccg
cagctgcccaatagctcccagctggactcagacaatgatggacttggagatgagtgtgat
ggggacgatgacaatgacggtgtcccagattacgtgcctcctggtcccgataactgtcgc
ctggtacccaatcccaatcagaaagattcagatggcaatggtgttggtgatgtgtgtgag
gatgacttcgacaacgacgcagtagtcgaccccctggatgtgtgccccgagagcgcggag
gtgaccctcacggatttccgggcctatcagaccgtcgtcctggatcctgagggtgatgct
cagattgaccccaactgggtcgtgctcaaccagggcatggagatcgttcagaccatgaac
agtgacccgggcctagcagtgggatatacggccttcaatggtgtggactttgaaggcacc
ttccacgtgaacacagtgacggatgatgactacgcaggcttcctcttcagctatcaggac
agcggccgcttctacgtagtcatgtggaagcaaacggagcagacctactggcaggccaca
cctttccgggctgttgcccagcccgggctacagctcaaggcagtgacatcggtgtctggc
ccaggtgagcacctccggaatgccctgtggcatacgggccacacccctgatcaggtacgg
ctgctgtggactgacccacgaaatgtgggctggcgtgacaagacctcctaccgctggcag
ttgctgcaccggcctcaagttggctacattcgggtgaagctttatgagggtccccagcta
gtggcggattctggggcgatcattgacacatccatgcgcggggggcgtcttggtgtattc
tgcttctcccaagaaaacatcatttggtccaatctccagtatcgatgcaatgacacagtt
cccgaggactttgagccattccggaggcagctgctccagggaagagtgtga

DBGET integrated database retrieval system