KEGG   Sus scrofa (pig): 100155108Help
Entry
100155108         CDS       T01009                                 

Gene name
THBS3
Definition
(RefSeq) thrombospondin-3
  KO
K04659  thrombospondin 2/3/4/5
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04145  Phagosome
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04512  ECM-receptor interaction
ssc05144  Malaria
ssc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100155108 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100155108 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100155108 (THBS3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100155108 (THBS3)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100155108 (THBS3)
   05144 Malaria
    100155108 (THBS3)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100155108 (THBS3)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100155108 (THBS3)
  Exosomal proteins of colorectal cancer cells
   100155108 (THBS3)
  Exosomal proteins of bladder cancer cells
   100155108 (THBS3)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100155108 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF EGF_MSP1_1
Motif
Other DBs
NCBI-GeneID: 100155108
NCBI-ProteinID: XP_013852472
Ensembl: ENSSSCG00000006524
Position
4
AA seq 956 aa AA seqDB search
METQELRGALALLFLCTFASASQDLQVIDLLTLGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSPALQLYVDCKLGDQHAGLPALAPIPPAEVNGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHSAVASALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCTDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTRVSGVGIDY
ARASKQVCNDIDECNDGDNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSHGCFPARTCHS
PAHSPCHVHAHCLFERNGAVSCLCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcttcctttgcactttcgcatct
gccagtcaggacctgcaggtgatcgacctgctgactctgggcgagtcccggcagatggta
gctgtggcggagaagattcggacagccctgctcaccgctggggacatctacctcttgtcc
accttccgtctgccccccaagcagggtggtgtcctctttggcctctactctcgccaagac
aacacacgatggctggaggcctctgttgtgggcaagatcaacaaagtgctggtgcggtac
cagcgggaggatggcaaagtccacgcggtgaacctacagcaagcaggcctggcagatggg
cgcacacacaccgctctcctgcgactccgaggcccgtccagacccagccctgccctgcag
ctgtacgtggactgcaaactgggcgaccagcatgctggccttccggcactggcccctatt
cctccagcagaggtcaatgggctggagattaggactggacagaaggcttatttgaggatg
cagggcttcgtggaatcaatgaaaatgattctgggcgggtccatggcccgggtcggagcc
ctgagtgagtgtccgttccagggggatgagtccatccacagtgcagtggccagtgcactc
cactccatcctaggggaacagaccaaagcgctggtcacccaactcaccctcttcaaccag
atcctggtagagctgcgggatgatatccgagaccaggtgaaagaaatgtccctgatccga
aacaccatcatggagtgtcaggtgtgcggcttccacgaacagcgctcccactgcagcccc
aacccctgcttccgaggcgtggactgcatggaggtgtacgagtacccaggctaccgctgt
gggccctgcccccccggcctccagggcaacggcacccactgcactgacatcaatgagtgc
gctcacgccgacccttgtttcccgggctccagttgcatcaacaccatgcccggcttccac
tgtgaggcctgtccccgaggctacaaaggcacacgggtgtctggcgtgggcattgactat
gcccgggccagcaagcaggtctgcaacgatatcgatgaatgcaatgatggggacaacggc
ggctgtgacccaaactccatctgcaccaatactgtgggctctttcaagtgtggtccctgt
cgcttgggcttcctgggcaaccagagccatggctgcttcccggcccggacctgccacagc
ccagcccacagcccctgccatgtccacgcgcactgtctctttgaacgcaatggtgcagtg
tcctgcttgtgcaacgtgggctgggccgggaacgggaacgtgtgcgggcctgacacagac
attgatggctacccggaccaggcgctgccctgcatggacaacaacaaacactgcaagcag
gacaactgccttctgacacccaactctgggcaggaagatgcagataacgatggcgtgggg
gaccagtgtgatgatgatgctgatggggacgggatcaagaatgttgaggacaattgccgg
ctgttccccaacaaggaccagcaaaactcagatacagattcatttggtgatgcctgtgac
aactgccccaacgttcccaacaatgaccagaaggacacagatggcaatggggaaggggat
gcctgtgacaacgacgtggatggggatggcatccccaatggactggacaattgccctaaa
gtccccaaccccctgcagacagacagggatgaagacggggtgggagatgcttgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagtgacctggtgggggatgtc
tgtgacaccaatgaagacagcgatggggatggacatcaggacaccaaggacaattgcccg
cagctgcccaatagctcccagctggactcagacaatgatggacttggagatgagtgtgat
ggggacgatgacaatgacggtgtcccagattacgtgcctcctggtcccgataactgtcgc
ctggtacccaatcccaatcagaaagattcagatggcaatggtgttggtgatgtgtgtgag
gatgacttcgacaacgacgcagtagtcgaccccctggatgtgtgccccgagagcgcggag
gtgaccctcacggatttccgggcctatcagaccgtcgtcctggatcctgagggtgatgct
cagattgaccccaactgggtcgtgctcaaccagggcatggagatcgttcagaccatgaac
agtgacccgggcctagcagtgggatatacggccttcaatggtgtggactttgaaggcacc
ttccacgtgaacacagtgacggatgatgactacgcaggcttcctcttcagctatcaggac
agcggccgcttctacgtagtcatgtggaagcaaacggagcagacctactggcaggccaca
cctttccgggctgttgcccagcccgggctacagctcaaggcagtgacatcggtgtctggc
ccaggtgagcacctccggaatgccctgtggcatacgggccacacccctgatcaggtacgg
ctgctgtggactgacccacgaaatgtgggctggcgtgacaagacctcctaccgctggcag
ttgctgcaccggcctcaagttggctacattcgggtgaagctttatgagggtccccagcta
gtggcggattctggggtgatcattgacacatccatgcgcggggggcgtcttggtgtattc
tgcttctcccaagaaaacatcatttggtccaatctccagtatcgatgcaatgacacagtt
cccgaggactttgagccattccggaggcagctgctccagggaagagtgtga

DBGET integrated database retrieval system