KEGG   Sus scrofa (pig): 100155158Help
Entry
100155158         CDS       T01009                                 

Gene name
USP37
Definition
ubiquitin specific peptidase 37
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 980 aa AA seqDB search
MSPLKIQGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNV
VLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLNAAMKPSQGSGSF
GAILGSRTSQKETHRQLSYSDNQVSSKRGSLETKDDIPFRKVLGNPGRASIKTAAGSGIT
ATRTIPSLTSTSTPLRSGLLENRTEKRKRMLSSGSELNEDYPKENDSSSNNKAMTDPSRK
YLTSSREKQLSLKQSEENRTSGLLPLQSSSFYGSRAASKDYSPSSTNLDRTNISSQTPSA
KRSLGFLPQPAPLSVKKLRCNQDYTGWNKPRLPLSSHQQQLQGFSNLGNTCYMNAILQSL
FSLQSFANDLLKQGIPWKKIPLNALIRRFAHLLVKKDICNSETKKDLLKKVKNAISATAE
RFSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKTEPVPGEENSPDVTATRVYTCPVITNL
EFEVQHSIICKACGEIIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYSCE
KCGGKCALVRHKFNRLPRILILHLKRYSFNVALSLNNKIGQQVIIPRYLTLSSHCTENTK
PPFNLGWSAQMAISRPLKASQMVNSCITSPSTPSKNFTFKSKSSLALSLDSDSEDELKRS
VALSQRLCEISSSEQQQEDLEKDSKSCKLEPDKSELENSGFDAMSEEELLAAVLEISKRE
ASPSPSHEDDDKPTSSPDTGFAEDDIQEMPENPDPMETEKPKTITEPDPASFTEITKDCD
ENKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAWEQKEDDDLKRATEL
SLQEFNNSFLDSLGSDEDSGNEDVLDMEYTEAEAEELKRNAETGNLPHSYRLISVVSHIG
STSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEASVQSDRDRSGYIFFYMHKEIFDELLE
TEKNSQALSMEVGKTTRQAS
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctctgaagatacaaggtcctatcagaattcgaagtatgcagactgggattaca
aagtggaaagaaggatcctttgaaattgtggaaaaagagaataaagtcagcctagtagtt
cattacaatactggaggaattccaaggatatttcagctaagtcataacattaaaaatgtg
gtgcttcgacccagtggagcaaaacaaagccgcctaatgttaactctacaagataacagc
ttcttgtctattgataaagtaccgagtaaggatgcagaggaaatgaggttgtttctagat
gcggtccatcaaaacagacttaatgcagccatgaaaccttctcagggttctggtagtttt
ggagctattctgggtagcaggacctcacagaaggaaacccacaggcaactttcttactca
gacaatcaggtctcttcaaaaagaggaagtttggaaactaaagatgatattccatttcga
aaagttcttggtaatccaggtagagcatcaattaaaactgcagcaggaagtggaataact
gctacccggacaattccctctttgacatctacgtcaacacctcttagatcagggttatta
gaaaataggactgaaaagaggaaaagaatgctatcatctggctcagagttgaatgaagat
tatcctaaggaaaatgattcatcatcgaacaacaaggctatgacagatccctcaagaaaa
tatttaaccagcagtagagagaagcagctgagtttgaaacagtcagaagagaataggaca
tcggggcttttacctttgcagtcatcatctttttatggtagcagagctgcatccaaggac
tactctcccagcagcactaacctagacaggactaatatttcaagccaaactccctctgca
aaaagaagtttgggatttcttcctcagccagctcctctttctgttaaaaaactgaggtgt
aaccaggattacactggctggaacaaaccaagactgcccctttcctctcaccaacagcaa
ctgcaaggcttctccaatttgggaaatacatgttatatgaatgctattttacaatctctg
ttttcactccaatcatttgcaaatgacttgctcaagcaaggtatcccatggaagaaaatc
ccactcaatgcgcttatcagacgctttgcacacttgcttgttaaaaaagatatctgtaat
tcagagaccaaaaaagatttactcaagaaggttaaaaatgccatttcagctacagcagag
agattctctggttatatgcagaatgatgctcatgaatttttaagtcagtgcttggatcag
ctgaaagaggatatggaaaaattaaataaaacttggaagactgaacctgttcctggagaa
gaaaattcaccagatgttacagctactagagtatacacttgccctgttattactaatttg
gagtttgaagttcagcactccatcatctgtaaagcatgtggagagattattcccaaaaga
gaacagtttaatgacctttccattgaccttcctcgaaggaaaaagccactccctcctcgt
tcaattcaagattcccttgatcttttctttagggcagaagaacttgagtattcctgtgag
aagtgtggtgggaaatgtgctcttgtcagacataaatttaacaggctacccaggatcctc
attcttcatttgaaacgatacagcttcaatgttgctctctcacttaacaacaagattggg
caacaagtcatcattccaagatacctgaccctgtcatctcattgcactgaaaatacaaaa
ccacccttcaaccttggttggagtgcacagatggcaatttctagaccattgaaagcctct
caaatggtgaattcctgcatcaccagcccttctacaccttcaaagaatttcaccttcaaa
tccaagagctccttggctttatcccttgattcagacagtgaggatgagttgaaacgctct
gtggcccttagccagagactttgtgaaatatcaagcagtgaacagcagcaggaagacctg
gaaaaggattcaaaatcatgcaaactagaacctgataagtctgaactagaaaactcagga
tttgacgcaatgagtgaagaagagcttctagcagctgttttagagataagtaaaagagaa
gcttcaccatctccgagtcatgaagatgatgataaaccaaccagcagccctgatactggg
tttgctgaagatgatattcaagaaatgcctgaaaatccagaccctatggaaaccgagaag
ccgaaaacaatcacagagcctgatcctgccagttttacagagataactaaagactgtgat
gaaaataaagaaaacaaaactccagaaggatctcaaggagaggttgattggctgcagcag
tatgatatggagcgtgagagggaagaacaagagctgcagcaggcattggctcagagcctt
caggagcaagaggcttgggaacaaaaagaagatgatgacctcaaaagagctacagagtta
agtcttcaagagtttaacaactcttttctggattcattgggctctgatgaggactctgga
aatgaggatgttttagatatggagtacacagaagccgaagctgaggaactgaaaagaaat
gctgagacaggaaatcttcctcattcttatcgactcatcagtgttgtcagtcacattggt
agcacttcttcttcaggtcattacattagtgatgtgtatgacattaagaagcaggcgtgg
tttacttataatgacctagaggtatctaagatccaagaggcttccgtgcagagtgatcgg
gatcggagtggttacatcttcttttatatgcacaaggagatctttgatgagcttctggaa
acagaaaagaactctcaggcacttagcatggaagtagggaagaccactcgtcaggcttca
tga

DBGET integrated database retrieval system