KEGG   Sus scrofa (pig): 100155173Help
Entry
100155173         CDS       T01009                                 

Gene name
POMT2
Definition
(RefSeq) protein-O-mannosyltransferase 2
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ssc  Sus scrofa (pig)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100155173 (POMT2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100155173 (POMT2)
Glycosyltransferases [BR:ssc01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100155173 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 750 aa AA seqDB search
MPPAVGGGLAGSELRPRRGRCGSQAPRAVGADAAAETTARSPKRPVPGSRRFEAVGQWAL
LALVTLMSFATRFHRLDQPPHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYL
SGYDGTFLFQKPGDKYEHHSYMGMRGFCAFLGSLLIPFAYLTVLELSRSLPAALLAAALL
TFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCASRPFSAPWWFWLSLTGVNLAGAL
GVKFVGLFIILQVGWNTLSDLWHLFGDLSVSMVTMGKHLTARILCLIVLPLALYTATYAV
HFMVLNKSGPGDGFFSSAFQARLAGNTLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRH
LYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPSLPVEFVRHGDIIRLEHKETS
RNLHSHYHEAPLTRKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLV
TGCVLGSSGKVLPKWGWEQLEVTCTPYLKETLSSVWNVEDHINPKLPNISLDVLQPSFPE
IMLESHMVMIRGNNGLKPKENEFTSKPWHWPINYQGLRFSGINDTDFRVYLLGNPVVWWL
NLLSIALYLLLGSIIAVAMQRGAQLPAQVEGLSQVLLRGGGQLLFGWMIHYFPFFLMGRI
LYFHHYFPAMLFSCMLTGVLWDTLLRLCAWSLSSFALARAVHALGILSLLLGIVYSFYLF
HPLAYGMVGPLAEDPRSPMAGLRWLESWDF
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgccaccggcggtgggcggaggcctggcagggtccgagctgcgtccccggaggggccgc
tgtgggtcccaggctccaagggccgtgggcgcggatgcggctgccgagactacagcgcgg
agccccaaacggcctgttccgggctcgcggcgcttcgaggcggtcggccagtgggctcta
ctggccctggtgacgctaatgtccttcgccacccgcttccatcgtctggaccagccgccg
cacatctgctgggatgagactcactttggaaaaatgggaagttactatatcaaccgcacc
tttttctttgatgtgcacccacctctgggaaagatgctgataggtcttgctggctacctg
agtggatacgatggcacctttttgttccagaagcctggggacaaatacgagcatcacagc
tacatggggatgagaggattctgtgcattcctcggctccctgctcatcccctttgcctac
ctcactgtgctggagctgtcccggtccctcccggcagcactgctcgcggctgccctcctc
acctttgacacaggatgcctcactctgtcccagtacatcctccttgaccccatcttgatg
ttcttcatcatggctgccatgctgagcatggtcaagtacaactcctgtgccagcaggcct
ttctctgccccctggtggttctggctcagtctgactggcgttaatctggctggtgctcta
ggggtcaagtttgttggcctctttatcatcctgcaagtggggtggaacaccctttcagac
ctttggcacctgtttggagacctcagtgtttcaatggtgactatgggaaaacacctgact
gctcgcatcctgtgcctcattgtgctgcccttggctctctacacagccacttatgctgtt
cacttcatggtgctgaataaaagtggtcctggcgatggcttcttcagttctgccttccag
gcccggcttgcaggaaacacccttcacaatgcttccatccccgaacacctggcctatggc
tctgtgatcactgtgaagaacctgcggatggccattggctacctccactcgcacaggcac
ctgtaccctgagggcatcggtgcccgccagcagcaggtcaccacctatttgcacaaggac
tacaacaacctgtggatcatcaagaaacataatacaaactcagatcccctagacccttca
ctcccagtggagttcgtaagacacggagacatcattcgactagaacacaaagagacttct
cggaacctgcacagtcactatcatgaggcccccctgacccggaagcactatcaggtcact
ggctatggcataaatgggacaggggactccaatgacttctggaggatcgaggtcgtaaac
agaaaatttggaaaccgcatcaaagtgctgaggagtcgaattcgcttcatccatctggtc
acaggttgtgtcctgggctcctcggggaaagtcctgcccaagtggggctgggagcagctg
gaagtcacctgcacaccatacctaaaggaaaccctcagctccgtctggaacgtggaggac
catatcaatcccaaattgccaaacatcagcctggacgtgctgcagcccagttttcctgag
ataatgctggagtcccacatggtgatgatccgggggaacaatggcctcaaacccaaagaa
aatgagttcacgtccaaaccctggcactggcccatcaactatcagggcctgcgcttctca
gggatcaatgacacggacttccgagtatatctgctcggcaacccggtggtttggtggctg
aatctgctaagcatcgccctctacctcctcttggggagcatcattgctgtggctatgcag
agaggggcacagctgcctgcccaggtggaagggctgtcccaggtcctgctgcgaggaggc
gggcagctcctgtttggctggatgatccattacttcccgttcttcctgatgggccggatc
ctctacttccaccactacttccccgccatgctcttctcctgcatgctgacaggcgtcctg
tgggacactctcctgcggctctgtgcctggagcctgtcctcctttgccctggccagggcc
gtacatgcgctgggaatcctgagcctgctcctgggaattgtctacagcttctacctcttc
caccctctcgcttacgggatggttggtcccctagccgaggacccccgaagtccgatggca
ggactcaggtggctggaatcatgggacttttga

DBGET integrated database retrieval system