KEGG   Sus scrofa (pig): 100155404Help
Entry
100155404         CDS       T01009                                 

Definition
(RefSeq) uncharacterized protein LOC100155404
  KO
K11252  histone H2B
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05034  Alcoholism
ssc05203  Viral carcinogenesis
ssc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100155404
  Immune diseases
   05322 Systemic lupus erythematosus
    100155404
  Substance dependence
   05034 Alcoholism
    100155404
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100155404
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100155404
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 100155404
NCBI-ProteinID: XP_020946481
Position
4
AA seq 421 aa AA seqDB search
MWFQSKGPTVTVAHTHLLTDYSPFCLFHFITLGSQLYLEHTKAPYLRVFVFATSSPGKAL
PPDIYMTDFVSSWALSKIPLVPLSVRPFLTNLSLEEPVGSLPIGLLILPVRGPCLALKVV
APEEKSSVLDWTAVAILHHLPPRRLQPFPKVSRGRPLPLPFLWSRFPRRQTSACSTHPGS
LCARRRLRKAETATGGRGVAPPSSPRAGSGQQRGFSPTRFREASGQSARLAFCGCRLGPL
GSRVLTPAGPEQLCWDGGRQTTRWLLCWVPRAIGHTRHLAPLYPPAAVATDRTRANFLPL
PALGTQIFLTGFVGGRLRKACTSPLTSAPLGIDSLRRRQWRPPRRAKVAMSTSGHGVAVA
AFRGIRSEHTASAGPGRRATTMVCPARSLAECSAEKLPWVNESNTFPLLRMVEMQEDSSL
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttcagagcaaaggtcccacagttacagtggcccacacccacctcctcactgac
tactctcccttttgtttgttccatttcatcacactaggctcccagctctaccttgaacac
accaaggccccctatctcagggtgtttgtatttgctacttcctctcctggaaaggctctt
cccccagatatttacatgactgacttcgtcagttcttgggctctgtcaaaaattccctta
gtccccttatcagtgaggccttttctgaccaacttatcccttgaagagcctgtaggctcc
ctgcccatcggcctgctgattctgcccgtccggggcccctgcctggctctgaaggtggtg
gcaccagaagaaaagtcatctgtgcttgactggacggccgtcgcgattctccaccatctc
cctccccgccgtctccagccatttcccaaagtgtcgcggggacgcccactgcctctcccc
ttcctgtggtccaggtttccgcggaggcaaacttccgcgtgctccacgcatcccggcagc
ctctgcgccagacggcgacttaggaaggctgaaactgcaacaggaggccgcggggtggcg
ccaccgtcaagtccgcgagcaggatctggccaacaaaggggtttttcacctacgcggttc
cgggaggcatctggccaatccgcgaggcttgctttctgcggctgccgactgggcccactc
gggagtcgggttctcacacctgctggccctgagcaattatgttgggatggggggcggcag
accacgcgttggctactctgttgggtaccaagggcaataggacacacgcgacaccttgct
cccctctacccgcccgccgccgttgccaccgaccggactagagctaatttcttgccgctg
ccggctctggggacgcaaatatttctcacagggtttgttggggggaggttgcggaaagcg
tgcacttcacccctgacctctgcgccgctgggaatcgattcactgcggcggcgacagtgg
cggcctccgcggcgagctaaggtagcaatgtccacaagtggccacggggtggcggtagcg
gccttccgcgggatacgctcggagcacaccgcctccgctggtccaggtcgaagagccacc
accatggtctgtccagccaggagcctggcagaatgttcagctgagaaactgccatgggtg
aatgaaagcaacacttttcccttactgaggatggtggaaatgcaggaagacagctctttg
aagtag

DBGET integrated database retrieval system