KEGG   Sus scrofa (pig): 100155431Help
Entry
100155431         CDS       T01009                                 

Gene name
B3GALT4
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Orthology
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
ssc  Sus scrofa (pig)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100155431 (B3GALT4)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100155431 (B3GALT4)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     100155431 (B3GALT4)
Glycosyltransferases [BR:ssc01003]
 Glycan extension
  Glycolipid
   100155431 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 377 aa AA seqDB search
MRLSLSRRLLLAALLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
EEACGGPGVPPFLLILVCTAPDNLNQRNAIRASWGRLREARGLRVQTLFLLGEPSGGSRE
NDLARESAAHGDIVQAAFQDSYRNLTLKTLSGLNWADKHCPMARYILKTDDDVFVNVPEL
VSELVRRGGHWEQWEQEPQRKAKVGDEEGGEGSPTSGSQPVPLLYLGRVHWRVHPSRTPG
GRHQIAEEQWPPAWGPFPPYASGTGYLLSASAVELILKVASRAPPLPLEDVFVGVSARRG
GLTPTHCVRLAGATHYPLDRCCYGRFLLTSHRLDPREMQEAWELVGGSDGRRTVPFCSWL
QGVLGILRCRVIAWLHS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctaagcctctcccggcgcctgctcctcgccgccctgctgttggtgattatctgg
actctatttggaccctcaggcctcggggaggagctgctgagtctctcgctggcctccctg
ctcccagccccggcctctcctgggccgcccctggccttgcctcgcctcttgatccccaac
gaggaggcgtgtggcgggcccggcgttcctccgttcctgctaatcctggtttgcacagcc
ccggacaacctgaaccagaggaatgccattcgggcctcgtggggccggctgcgcgaggcc
cgggggctcagggtgcagactctctttctgctgggagagcctagcggaggctccagagag
aacgacctggccagggagtcagctgcccatggggatatcgtgcaggcggccttccaggac
tcctatcgcaatctcaccctcaagaccctcagcgggctgaactgggctgacaaacactgc
cccatggcccgctacattctcaagactgacgacgacgtgtttgtcaatgtcccagagctg
gtatcagagctggtccggcgagggggccattgggagcaatgggagcaggagccccagaga
aaggctaaggttggtgatgaggagggtggggaaggaagccccacctcggggagccagccg
gtgcctctcttgtacttgggccgggtgcactggcgggtgcacccttctaggacgccagga
ggcaggcaccagatagcagaggagcagtggcctcccgcctggggccccttccccccttac
gcctcaggaacgggatacctgctgtcagcatctgctgtggagctcatcctgaaagtggcc
agcagagcaccccctctgccactggaggatgtctttgtgggggtaagtgcccgacgagga
ggcctcacccccacccactgtgtcaggctggctggcgccacccactaccccctggaccgg
tgctgctacgggaggttcctgctgacctcccataggttggaccccagggagatgcaggag
gcctgggagctggtgggtggctctgatggccgaagaactgtacccttctgctcctggctg
cagggagtgctgggcatcctccggtgtcgggtcatagcctggcttcacagctga

DBGET integrated database retrieval system