KEGG   Sus scrofa (pig): 100155530Help
Entry
100155530         CDS       T01009                                 

Gene name
COMT
Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ssc00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ssc00350]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:ssc04728]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 270 aa AA seqDB search
MLEALPLLLAVCSLVLVLLTLLWLLPHSKCSLIFIAWEEFILLPVRNLLMGSSKEQRILQ
YVLQHAVAGDPESVLDTIDTYSSQKEWAMHVGRKKGQIVDTVVQEQRPSVLLELGAYCGY
SAVRMARLLLPSARLLTIELNPDNAAIAQQVVDFAGLQDRVTVVVGASQDIIPQLKKKYD
VDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGCGRFEC
THFSSYLEYSQMVDGLEKAVYKGPGSPAQP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgctagaggccctgcccctgctgctggcagtctgctccttggtcctggtgctgctgaca
ctgttgtggctgctgccacactcgaagtgctctctcatcttcattgcctgggaagagttt
atcctgcttcccgtcaggaacctcctcatgggcagcagcaaggaacagcgcattctgcaa
tatgtgctgcagcacgcagtggcgggggacccagagagcgtgctggacaccatcgacacc
tactcctctcagaaggagtgggccatgcacgtgggcagaaagaaaggccagatcgtggac
actgtggtgcaggagcagcgtccttctgtgctgctggagctgggggcttactgtggctac
tcggctgtgcgcatggcccgcctgctgctgcccagcgcccggctgctgaccatcgagctt
aaccctgacaatgctgccatcgcccagcaggtggtggacttcgcaggcctgcaggacagg
gtgaccgttgtcgtcggggcatcccaggacatcatccctcagctgaagaagaaatatgat
gtggatacgctggacatggtctttcttgaccactggaaggaccggtacctgccagacacg
ctcctgctagaggaatgtggcctgctgcggaagggaacggtgttgctggccgacaacgtc
atctgcccgggggccccagatttcctggcacacgtgcgagggtgcggccgcttcgagtgt
acacactttagctcatacctggagtactcgcagatggtggatggcctggagaaggctgtc
tacaagggcccaggcagccctgcacagccttga

DBGET integrated database retrieval system