KEGG   Sus scrofa (pig): 100155655Help
Entry
100155655         CDS       T01009                                 

Gene name
GBA2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ssc  Sus scrofa (pig)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100155655 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100155655 (GBA2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100155655 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 915 aa AA seqDB search
MGTRVPASEPTSCATGDPQTYYPEDIGGTETAQVTDCQNPEDNQPQNEPSHSNPEDSGQL
MVSYEGKAEGYQVPPFGWRICLAHEFAEKRKPFNANDISLSNLIKHFGMGLRYLQWWYRK
TRVEKKTPFIDLINCVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYRHQTVIAD
QFTVCLRRKGQTVYQQVLSVEHPSVLRSWNWGLCGSFAFYHALYPRAWTVYQLPGQSVTL
TCRQITPILPHDYQDSSLPVGVFVWDAENEGDETLDVSIMFSMRNGLGGDEDAPGGLWNE
PFCLERDGETIQGLLLHHPTLPNPYTMAMAARLTADTTVTHITAFDPDGTGQQVWQDLLX
DGQLDSPAGQSPPSQKGVGIAGAVCVTTRLPPGGRRRLEFSLAWDMPRIMFGAKGQVYHR
RYTRFFGPDGDAAPALSHHALSRYADWEERISAWQSPVLDDRSLPAWYKSALFNELYFLA
DGGTVWLEVPEDSLPEDLVGSMCQLRPILQEYGRFGYLEGQEYRMYNTYDVHFYASFALI
MLWPKLELSLQYDMALATLREDLTERRYLMSGITAPVKRRNVIPHDIGDPDDEPWLRVNA
YVVHDTADWKDLNLKFVLQVYRDYYLTGDQVFLRDMWPVCLAVMESEMKFDKDQDGLIEN
GGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAALCGTREVQDQFSSILSRGREAYER
LLWNGRYYNYDCSSQPQAYSIMSDQCAGQWFLRASGLGEGDTEVFPTPHVVQALQTIFEF
NVQAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYALAATMIQEGLTWEGFRTAEGC
YRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKASGPTAKQDTG
QSSGLKPGPKEAMQT
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccagagtcccagcctcggagccgaccagctgtgccacaggggatccgcagact
tattaccctgaagatattggaggcactgagactgcgcaggttacggactgccagaaccct
gaggacaatcaaccccaaaatgagccgagccacagcaatccagaggactctgggcagctg
atggtttcctatgagggtaaagcggagggctaccaggtgcctccctttggctggcgcatc
tgcctggctcatgagtttgcagagaagagaaaaccctttaatgccaacgacatctccctg
agcaacctgataaagcattttgggatgggcttgaggtacttgcagtggtggtaccggaag
acccgggtagagaagaagacacctttcatcgacctcatcaattgcgtgcccctgagacag
atctatggttgccccttaggtggcattgggggaggcaccatcacccgaggctggagaggc
cagttctgtcgttggcagcttaatccgggaatgtaccgacaccagacagtcattgctgac
caattcaccgtgtgcttgcgtcggaaagggcagaccgtgtaccagcaggtcctgtccgtg
gagcaccccagtgtcctgcgcagctggaactggggcctgtgtgggtcctttgcattctac
cacgccctctatccccgagcttggacggtctatcagctccccggccagagtgtcaccctc
acctgccgccagatcacacccatcttgccccacgactaccaggacagcagcctgccggta
ggagtctttgtgtgggatgcggaaaatgaaggggacgaaaccctggatgtatccatcatg
ttctccatgcggaatggactggggggtgacgaggatgccccaggaggcttgtggaatgag
cccttctgtctggagcgtgatggggagacgatacaggggctgctgctgcatcatccaacc
cttccaaatccctacacgatggctatggctgctcgactcacggcagacaccacggtaacg
cacatcacagcctttgaccccgatggcactgggcagcaggtgtggcaggatctacttnca
gatggacagctggactcccccgctggccaaagccccccctcgcagaaaggagtgggcatc
gccggggccgtgtgtgttaccaccaggctgccacctggaggccggcgccgcctggagttc
tcgctggcttgggacatgcccagaatcatgtttggagccaagggccaggtctaccacagg
cggtacaccaggttctttggtccagatggcgacgcagcacccgcccttagccaccacgca
ctgagcagatacgcagactgggaagagaggatctccgcctggcagagcccggtattggat
gacagatccttgcctgcctggtacaaatctgcactgttcaatgaactatacttcctggcg
gatgggggcacagtgtggctggaagtccccgaggactcactgccagaggacctggtgggc
agcatgtgtcagctccgccccatcctgcaggagtacggtcgcttcggctaccttgaaggc
caggaatatcgcatgtacaacacatatgacgtccacttttatgcttcctttgccctcatc
atgctctggcccaaactcgagctcagcctgcagtatgacatggctctggccactctcagg
gaggacctgacagagcgacggtacctgatgagtgggatcacagcacctgtgaaaaggagg
aacgtcatccctcacgatatcggggacccagatgacgagccatggctccgggtcaatgca
tacgtggtccacgacactgctgactggaaggacctgaacctgaagtttgtgctgcaggtt
tatcgggactattacctgacgggtgaccaggtcttcctgagggacatgtggcctgtgtgt
ctggctgtgatggagtctgaaatgaagtttgacaaggaccaagacggactcattgagaac
ggaggctatgcagaccaaacctatgatggatgggtcaccacaggccccagtgcttactgt
ggaggactgtggctggcagctgtggctgtgatggtccagatggctgctctgtgtgggacc
agggaggtccaggatcagttttcttccatcctcagccggggccgagaagcctatgagaga
ctgctctggaacggccgttattacaactatgactgcagctctcagcctcaggcctatagc
atcatgtctgatcagtgtgccggccagtggttcctgagggccagtggcctaggagaagga
gatactgaggtatttcctaccccacacgtggtccaagctctccagaccatctttgagttc
aatgtccaggcctttgcaggaggggccatgggggctgtgaatggaatgcagccccatggt
gttcctgatagatccagcgtccagtctgatgaagtctgggtgggtgtggtctacgcgctg
gcagccaccatgatccaagagggcctgacctgggagggcttccgtacagcagaaggctgc
taccgtactgtgtgggagcgcctgggcctggccttccagacccctgaggcatactgccag
cagcgggtgttccgctcactcgcctacatgcgaccactgagcatctgggccatgcagcta
gccctgcagcagcagcagcataaaaaggcctctgggccaacagccaaacaggacacagga
caaagctccggcctaaaacctggaccaaaggaagccatgcaaacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system