KEGG   Sus scrofa (pig): 100155768Help
Entry
100155768         CDS       T01009                                 

Gene name
CLK3
Definition
CDC-like kinase 3
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100155768 (CLK3)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100155768 (CLK3)
Spliceosome [BR:ssc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100155768 (CLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 490 aa AA seqDB search
MHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRR
YREHRDSDTYRCEERSPSFGEDCYGSSRSHHRRRSREREPYRTRKHAHHCHKRRTRSCSS
ASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGK
SQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLG
KNTFEFLKENNFQPYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLY
NEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDVWSI
GCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSD
GRYVKENCKPLKSYMLQDSLEHVQLFDLMRKMLEFDPAQRITLAEALLHPFFAGLTPEER
SFHTSRNPSR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcatcactgtaagcgataccgctcccctgagccagacccgtacctgagctaccgatgg
aagaggaggaggtcttacagtcgggagcatgaagggagactgcgatacccatctcgaagg
gagcctccgccccgaagatctcggtctagaagtcatgaccgcctaccctaccagaggagg
tacagggagcaccgtgacagcgacacataccggtgtgaagagcggagcccatcctttgga
gaggactgctatggatcttcacgttcccatcatcgacggcggtcacgggagagggagccc
taccggacccgcaagcacgcccaccactgccacaaacgccgcaccaggtcttgtagcagc
gcctcctcgagaagccaacagagcagtaagcgcagcagccggagtgtggaagatgacaag
gagggccacctggtgtgccggatcggcgattggctccaagagcgatatgagatcgtgggg
aacctgggtgaaggcacctttggcaaggtggtggagtgcttggaccatgccagagggaag
tctcaggttgccctgaagatcatccgcaacgtgggcaagtaccgggaggccgcccggcta
gaaatcaatgtgcttaaaaaaatcaaggagaaggacaaagagaacaagttcctgtgcgtc
ttgatgtctgactggttcaacttccatggtcacatgtgcatcgcctttgagctcctgggc
aagaacacctttgagttcctgaaggagaataacttccagccttaccctctaccgcatgtc
cggcacatggcctaccagctctgccacgcccttagatttctacacgagaaccaactgacc
cacacagacttgaagccagagaacatcctgtttgtgaactcggagtttgaaaccctctac
aatgagcacaagagctgtgaggagaagtctgtgaagaacaccagcatccgagtggctgac
ttcggcagtgctacctttgaccacgagcatcacacaactatcgtggccacccgtcactat
cgcccacctgaggtcatcctcgagctgggctgggcacagccctgtgacgtctggagcatt
ggctgcattctgtttgagtactaccggggcttcacactcttccagacccatgagaatcga
gaacatttggtgatgatggaaaagatcctagggcccatcccatcccacatgatccaccgg
accaggaaacagaagtatttctacaaagggggcctggtttgggatgagaacagctctgac
ggccggtatgtgaaggagaactgcaaacctctgaagagttacatgctccaagactcgctg
gagcacgtgcagctgtttgacctgatgaggaagatgttagaattcgaccctgcccagcgc
attacactggcggaggccctgctgcaccccttctttgctggcctgacccctgaggagcgg
tccttccacaccagccgcaacccaagcagatga

DBGET integrated database retrieval system