KEGG   Sus scrofa (pig): 100155893Help
Entry
100155893         CDS       T01009                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100155893 (ARG2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    100155893 (ARG2)
   00330 Arginine and proline metabolism
    100155893 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100155893 (ARG2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100155893 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 354 aa AA seqDB search
MSLRSSLSRLLRTQVHSAPKKSVHSVAVIGAPFSRGQKRKGVEYGPAAVREAGLMKRLSD
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSGGYSCVTVGGDH
SLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYITEEIHNTGLLSALDLVEVNPR
LAASEEEAKATASLAVDVIASSFGQTREGGHIVYDHLPTPSSPEESDSEERVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaggagcagcctctcgcgtctcctccggacgcaagtgcattccgccccgaag
aagtccgtccactccgtggctgtcattggagccccattctcacgggggcagaaaagaaaa
ggagtggaatatggtccagctgctgtaagggaagctggcttgatgaaaaggctctctgat
ttgggctgccaccttaaagacttcggagatttgagttttactccagttcccaaagatgat
ctctacaacaacctgatagtgaatcctcgctcagtgggcctcgccaaccaggaactagca
gaggtcgtcagtagagcggtgtcaggtggctatagctgtgtcacggtgggaggagaccac
agcctggcaattggtaccattagtggccacgcccggcactgcccagacctttgtgtgatc
tgggttgatgcccatgctgacatcaatacacccctcaccacttcatctggaaatctccat
ggacaaccagtttcatttctcctcagagaactacaggacaaggtaccacaactcccagga
ttttcctggatcaagccttgtatctcttccccaagtattgtgtatattggactaagagac
gtggaccctcctgaacattttattttaaagaattacgatatccagtatttctctatgaga
gacatagatcgacttggtatccagaaggtcatggaacagacgtttgatctgctgattggc
aaaagacaaaggccaatccatctgagttttgatattgatgcatttgaccctaccctggct
ccagccacaggaactcctgttgtagggggactaacctatcgagaaggcatgtatattact
gaggaaatacacaatacagggttgctctcagcattggatcttgttgaagtcaatcctcgg
ctggccgcttcagaggaagaggccaaggctacggccagcctggcagtggatgtgattgct
tcaagttttgggcagacaagggagggagggcacattgtctatgaccaccttcctactccc
agttcaccagaggaatcggacagtgaagaacgtgtacggatttag

DBGET integrated database retrieval system