KEGG   Sus scrofa (pig): 100156127Help
Entry
100156127         CDS       T01009                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone H2B type 1-M
  KO
K11252  histone H2B
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05034  Alcoholism
ssc05203  Viral carcinogenesis
ssc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100156127
  Immune diseases
   05322 Systemic lupus erythematosus
    100156127
  Substance dependence
   05034 Alcoholism
    100156127
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100156127
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100156127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 100156127
NCBI-ProteinID: XP_001927974
Ensembl: ENSSSCG00000026757
UniProt: F2Z584
Position
7
AA seq 126 aa AA seqDB search
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRXTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccaacgaaatctgctccagccccgaagaagggctccaagaaagccgtgacc
aaggcgcagaaaaaagatggcaagaagcgcaagcgcagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggtgaggcctcgcgg
ctggcgcattacaacaagcgtncgaccatcacgtcccgggagatccagacggccgtgcgg
ctgctgctgcccggggagttggccaagcacgccgtgtctgagggcaccaaggccgttacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system