KEGG   Sus scrofa (pig): 100156602Help
Entry
100156602         CDS       T01009                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04062  Chemokine signaling pathway
ssc04068  FoxO signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04630  Jak-STAT signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04714  Thermogenesis
ssc04722  Neurotrophin signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04926  Relaxin signaling pathway
ssc05034  Alcoholism
ssc05160  Hepatitis C
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100156602 (SOS2)
   04010 MAPK signaling pathway
    100156602 (SOS2)
   04012 ErbB signaling pathway
    100156602 (SOS2)
   04630 Jak-STAT signaling pathway
    100156602 (SOS2)
   04068 FoxO signaling pathway
    100156602 (SOS2)
   04072 Phospholipase D signaling pathway
    100156602 (SOS2)
   04151 PI3K-Akt signaling pathway
    100156602 (SOS2)
   04150 mTOR signaling pathway
    100156602 (SOS2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100156602 (SOS2)
   04540 Gap junction
    100156602 (SOS2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100156602 (SOS2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100156602 (SOS2)
   04660 T cell receptor signaling pathway
    100156602 (SOS2)
   04662 B cell receptor signaling pathway
    100156602 (SOS2)
   04664 Fc epsilon RI signaling pathway
    100156602 (SOS2)
   04062 Chemokine signaling pathway
    100156602 (SOS2)
  Endocrine system
   04910 Insulin signaling pathway
    100156602 (SOS2)
   04912 GnRH signaling pathway
    100156602 (SOS2)
   04915 Estrogen signaling pathway
    100156602 (SOS2)
   04917 Prolactin signaling pathway
    100156602 (SOS2)
   04926 Relaxin signaling pathway
    100156602 (SOS2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100156602 (SOS2)
  Environmental adaptation
   04714 Thermogenesis
    100156602 (SOS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100156602 (SOS2)
   05231 Choline metabolism in cancer
    100156602 (SOS2)
   05206 MicroRNAs in cancer
    100156602 (SOS2)
   05205 Proteoglycans in cancer
    100156602 (SOS2)
   05210 Colorectal cancer
    100156602 (SOS2)
   05225 Hepatocellular carcinoma
    100156602 (SOS2)
   05226 Gastric cancer
    100156602 (SOS2)
   05214 Glioma
    100156602 (SOS2)
   05221 Acute myeloid leukemia
    100156602 (SOS2)
   05220 Chronic myeloid leukemia
    100156602 (SOS2)
   05211 Renal cell carcinoma
    100156602 (SOS2)
   05215 Prostate cancer
    100156602 (SOS2)
   05213 Endometrial cancer
    100156602 (SOS2)
   05224 Breast cancer
    100156602 (SOS2)
   05223 Non-small cell lung cancer
    100156602 (SOS2)
  Substance dependence
   05034 Alcoholism
    100156602 (SOS2)
  Infectious diseases
   05160 Hepatitis C
    100156602 (SOS2)
   05165 Human papillomavirus infection
    100156602 (SOS2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100156602 (SOS2)
   01522 Endocrine resistance
    100156602 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 100156602
NCBI-ProteinID: XP_020957098
Ensembl: ENSSSCG00000005015
Position
1
AA seq 1332 aa AA seqDB search
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
LAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNILDIHELTVKLLGLVEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPEFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALLNLQGSMDRIYKQHSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRVGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSNAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSIIFAAKSAEEKSNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGNSSEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETDLESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPAPTGVFDGPL
PSPPLPPPRDPLPDTPPPVPLRPPEHFINCPFTLQPPPLGHLHRDPDWFRDVSMCPNSPN
TPPSTPSPRVPRRCYVLSSSQNNLAHPQAPPIPPRQNSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccctacgagttcttcagcgaagagaacagtccgaaatggcgg
ggactcttagtctcggccctgcggaaggttcaggaacaagtacatcccaatctctcagca
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
ctggcccaaccaaggactgttcaagatgtggaggaacgagttcagaagacttttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcctctcttgctgcctgtggataaaatccatccttcattgaaggaagttttagggtac
aaggtggactaccatgtatccctgtatattgtggctgtactagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatcccaacaa
gacattaaagtgtcaatgtgtgcagataaggtattgatggacatgtttgatcaggatgac
ataggcttggtttctctctgtgaagatgaacctagttcttcaggtgaattaaactactac
gaccttgtcagaactgaaattgcagaagaaaggcagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcttttctttctgacagaaagctttttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgaattgacggtgaaacttttaggtttg
gttgaagacacagttgaaatgactgatgaaagcagccctcatcccttagctggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacgttatcacaggatatt
ctttcaccagaatttaatgaacatttcagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggctttaaagaggcagttcgctatgttcttccccgccta
atgttggtgccagtgtatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcaggaagacagagagtgtttgaaccaagctataacagctctcttgaac
ctccaaggtagtatggaccgaatttacaagcagcattcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcaattaagaagcaaacacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggctgggaaggcaaagatattggacagtgttgtaat
gaatttattatggaaggcccattgacaagagttggtgctaaacatgaacgacatattttt
ctttttgatggcttaatgattagttgcaaacccaatcatagccagtcacgccttccagga
tacagtaatgcagaatacagattaaaagaaaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacttgtgagtacaaacatgcttttgaattagtatccaaagatgaaaac
agcataatattcgctgctaagtctgctgaagagaaaagtaattggatggcagcacttatt
tctcttcattatcgtagtactctggatcgaatgctagattcagtattgttgaaggaagaa
aatgaacaaccactgagattaccaagtcctgaagtgtatcgttttgtggtaaaggactct
gaagaaaacattgtttttgaagacaacttgcaaagtagaagtggaatccccattattaaa
ggaggaactgtagtgaaattaattgaaaggttaacttatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacgtatcgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggca
gtagagaaaggcgagcagcctatcagtgcagaccttaaaagatttcgcaaggaatacgtc
caaccagtacaacttaggatcttaaatgtgtttcggcactgggttgaacatcatttttat
gactttgaaagagatttggagttgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagattatcaagaggaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagcccacctcccccaattgaa
tggcatatcagtagaccaggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcagctaacacttttggaatctgatctctacaggaaagtccaaccttct
gaacttgtagggagtgtatggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgtcacaccacaaatctcaccctctggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcagtactgagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattggagatcgtcagtgcagtaaattcagtgtca
gtttatagactagatcatacctttgaggcattgcaggaaagaaaaaggaaaattttggat
gaagctgtggaattaagtcaagatcattttaaaaaatatctagtgaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcagtatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggaggttctttgaaaaccttaaccccatgggaaattcttctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaattgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggtactttacgaggccatccaacaccattagaa
agagaaccatgtaaaataagctttagtcggattgctgaaacagaccttgaatcaacagtg
tcagcaccaacctctccaaacacaccatctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggaagcaatagcatctttgctcca
gtcctcttgccacattcaaagtctttcttcagttcatgtggtagtttacataaactaagt
gaagagccactgattcctcctccgcttcctcctcgaaaaaagtttgatcatgatgcttca
aattccaagggaaatatgaaatccgatgatgacccccctgctattccgccaagacaacct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgtgtttgacggacctctg
cctagtccacctctaccaccgccaagagatcctcttcctgatacccctccaccggttccc
cttcggcctccagaacactttataaactgtccattcactctccagccacctccactggga
catcttcacagagatccagactggttcagagatgttagtatgtgtccaaattctccaaac
actcctccaagcacaccatctccaagagtaccacgtcgatgctatgtgctcagttctagt
caaaataatctcgctcatcctcaagccccccccattccaccaaggcagaattcaagccct
cacctaccaaaactgccaccaaagacttataaacgggagctttcgcaccccccattgtat
agactgcctttgctagaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system