KEGG   Sus scrofa (pig): 100156636Help
Entry
100156636         CDS       T01009                                 

Gene name
KAT6B, MYST4
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100156636 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 2065 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLSGTTTNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGGLD
GKGAPKYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
PGTTQKLKPPPSSLPPPTPMSGQSPSSQKSSTSASSTSPQSSSSQSSVPSFSSLTNNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTEFSSTAKSKAHFFGKRDIRSRFISH
SSSSSWGMARGRIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKISIKQESTDINVIGNKDTVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILGHMEKLKTCSRTNELDPESLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSSRANSRQSPAKVQSKNKYLHSPESRPVAGERGQLMELSKESSEEEEEEEEEEE
EEEEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINSS
VTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGGKPVLRKAFQHQPGKKRQT
EEEEGKDNHCFKNADPCRNNMDGDANNLKEASRDNPEPLKCKQWPKGAKRGLSKWRPNKE
RKTGFKLNLYTPPETPMEPDDQVTVEEQKETPEDKSSPTPTRIEEEVKEAMEPLLPQDEN
RREETCAPISPNKSPCEKPEDGIIKPEEEEEEEEEEEEEEEEEEEEANVEKDPAGAKSQE
KEEPPEACTDKEDPVRLDDREEEEEEDEEPSHNEGHDADDEDDSHTESAEAEKEERPREA
FKEVLENQEAFLDLSVQPSHSNPEVLMDCGVEDLTASCSSDPKELAGATETAPESDEEPP
GDPAQKQDQKSSEDVDPEFKEGNAATLEIDSETVQAVQSLTQENREQDDTFQDCAETQEA
CRSLQNYNHADQSPQIATALDDCQQSDHSSPVSSVHSHPGQSVRSVSSPSVPALENSYAQ
ISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDS
TMGGSICGNGSSQNSCSYSNLTSSNLTQSSCAVTQQMSNISGSCSMLQQTSISSPPTCSV
KSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETGNANLGLYERMGQSDFGAGHY
PQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSV
PGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTK
SASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPSPAYNVNSVNMNMNT
LNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHSNMMY
TAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6198 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaatt
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcagtcagcacttcccac
gggttggataagaagacggtctctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcaaccaaggggtctagaggatcatgtaat
gatctccgaaacgtggattggaataaactgctaaggagagcaatcgaaggacttgaggag
cccaatggctcctccctgaagaacatagagaagtatctcagaagtcaaagcgatctctcg
ggcaccaccaccaacccagcctttcagcagcggctgcgactgggagcgaaacgcgcagtg
aataatgggaggttactgaaggacgggccgcagtacagggtcaactacgggggcttagat
ggcaaaggggctcccaaataccccagtgctttcccatcctcgctcccaccggtcagcctt
ctaccccatgagaaagaccagccccgtgccgatcccattccaatatgtagcttctgtctg
gggacaaaagaatcaaatcgtgaaaagaaaccagaagaactcctttcttgtgcagattgt
ggcagtagcggacacccgtcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacatgcagtgcatgtagaatccaaggcaaa
aatgcagataatatgcttttttgtgactcctgtgatagaggattccatatggagtgctgt
gatcccccactctccagaatgccgaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
ccaggtaccacacaaaagctaaaacctccaccttcttcactcccacccccaacccccatg
tctggtcagagccccagttcacaaaagtccagcacttctgcttcttctacctctccccag
agttcttccagccagtccagtgtgccctcctttagcagtcttactaataacagccagctg
aaggcactctttgacggactctctcatatctataccactcagggacagtctcgcaaaaag
ggacacccaagttatgcaccacctaaacgtatgcgtcgtaaaaccgagttctcttccacg
gcaaaatctaaagcccatttctttggaaagagagatattagaagtaggtttatttctcac
tcctcctcctctagctgggggatggctagaggacgtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcagattaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatacggaaatcaaaataagcatcaaacaagaaagtacagatataaat
gtgattggaaacaaggataccgttactgaagaggatttggatgtttttaaacaggcccag
gaactgtcttgggagaaaatagagtgtgaaagtggagtagaagactgtggccggtaccct
tctgtaatagaatttgggaagtatgaaatccaaacctggtattcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttgttaagacactcaaagaaatgtggatggtttcatcctccagcaaatgaa
atttaccgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgat
gtcgagccattccttttttatgttcttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatc
atgcctcagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctagaagagaaggccaagcagggtctcctgaaaagccactctctgacctgggccgtctc
tcctacctggcctattggaagagtgtcatcttagaatatctctaccaccaccatgagagg
cacatcagcatcaaggccatcagcagagctacgggcatgtgcccccatgacatcgccacc
accctgcagcacctccacatgattgacaaaagggacggcagatttgtcatcattagacgg
gaaaagttgatattgggccacatggaaaagttgaaaacctgttcccggaccaatgaactt
gatccagagagtctaaggtggaccccaattttaatttctaatgctgcggtttctgaagaa
gaacgggaagcggaaaaagaggccgagcggctaatggaacaagctagctgctgggaaaag
gaggagcaagaaatcctgtcatctagagctaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtggcaggggagcgagggcag
ctgatggagctctctaaggagagcagtgaagaggaggaggaggaggaagaggaggaggaa
gaagaggaggaggaggaagaagaagaggaggaggaggaggaggaagaggaagaggaagaa
gaaaatattcagagctctcctccaagattgactaaaccacagtcagttgccataaagaga
aagaggccttttgtactaaagaagaaaaggggtcggaaacgcaggaggatcaacagcagt
gtaacaaccgagaccatttctgagacgacagaagtactgaatgagccctttgacaactcc
gacgaagagaggccaatgccacagctggagcctacctgtgagattgaggtagaggaggac
ggcgggaagccagtcctgcgaaaagcattccaacaccagcctgggaagaaaagacagaca
gaggaagaggaaggaaaagacaatcattgctttaagaatgctgacccttgtagaaacaat
atggatggtgatgcaaataacttgaaagaagccagcagagacaatcctgaacctctaaag
tgcaagcaatggccaaaaggagcaaagcgtggtctctctaagtggaggccaaacaaagag
aggaagactggatttaaactgaacttgtacaccccaccagaaacccccatggaacccgat
gaccaggtaacagtggaagaacagaaggagaccccggaggacaaaagcagccccactccc
accaggattgaggaagaggtcaaggaagccatggaacccctgctgcctcaggacgaaaac
agaagggaggaaacgtgtgcccctataagtccaaataaatcaccatgtgaaaaaccagaa
gatggtataatcaaacctgaggaggaagaggaggaagaggaggaggaagaagaagaggaa
gaggaagaagaagaagaagcaaacgtagaaaaagaccccgctggtgccaaaagtcaggaa
aaagaagagccaccagaagcctgcacagacaaagaagatcctgtgcgtttggatgaccgt
gaagaggaggaagaagaggatgaagagccatcgcacaacgaggggcatgatgcagatgat
gaggacgacagtcacacggagtctgccgaagccgagaaggaagagcgcccgagagaagcc
ttcaaagaagtactggaaaaccaggaggcttttttagaccttagtgtccagcctagtcat
tcaaacccagaggtcctcatggactgtggtgttgaagacctcacagcctcttgcagcagt
gaccctaaggagcttgctggagccactgaaactgcacccgagtctgatgaggagcctcca
ggagacccggcccagaagcaggaccaaaagagcagtgaagacgtagatcctgagttcaaa
gagggaaatgcagcaaccttggaaatcgactctgagaccgtccaagcggttcagtccttg
acccaggagaacagagaacaggacgacacctttcaggattgtgccgagactcaagaggcc
tgtagaagcctccagaactacaaccacgcagaccaaagcccacagattgccaccgctcta
gacgactgccagcagtcagatcacagtagcccagtgtcctctgtccactcccatcccggc
cagtcagtgcgttctgtcagcagtccaagtgtccccgccctggaaaacagctatgcccaa
atcagcccagatcaaagtgccatctcggtgccatctttgcagaacatggaaaccagtcca
atgatggatgtcccatctgtttcggatcattctcagcaagtcgtcgacagcggatttagt
gacctgggcagtatcgagagcacaaccgagaactacgaaaacccaagcagctatgattct
actatgggtggcagcatttgtggaaacggctcttcccagaacagctgctcctatagcaac
ctcacctccagcaatctgacacagagcagctgtgctgtcacccagcagatgtccaacatc
agtgggagctgcagcatgctgcagcagaccagcatcagctcacccccgacctgcagcgtc
aagtctcctcagggctgcgtggtggagaggcccccgagcagcagccagcagctggcccag
tgcagcatggccgctaacttcacgccacccatgcaactggctgagatccccgagaccggc
aacgccaaccttggcttatatgaacgaatgggtcagagtgattttggggctgggcactac
ccacagccgtcagccaccttcagccttgccaaactacagcagttaactaatacacttatt
gatcattcattgccttacagccattccgctgctgtaacttcctatgcaaacagtgcctct
ttgtccacaccattaagtaacacagggcttgttcagctttctcagtctccacactccgtc
ccagggggaccccaagcacaagcgaccatgaccccaccccccaatctgactcctcctccg
atgaatctgccaccgcctcttttgcaacggaacatggctgcgtcaaatattggcatctcc
cacagccaaagactgcaaacccagattgccagcaagggccacgtctccatgagaaccaaa
tcggcatctctgtcaccagccgctgccacccatcagtcacaaatctatgggcgctcccag
accgtagccatgcagggtcccgcacggactttaacgatgcagagaggcatgaacatgagt
gtgaacctgatgccctccccagcctacaacgtcaactccgtgaacatgaacatgaacact
ctcaacgccatgaatgggtacagcatgtcccagccgatgatgaacagtggctaccacagc
aatcatggctacatgaatcaaacgccccagtaccctatgcagatgcagatgggcatgatg
ggaacccagccatacgcccagcagccaatgcagaccccgccccacagtaacatgatgtac
acggcccccggacatcacggctacatgaacacgggcatgtccaaacagtctctcaacggg
tcctacatgagaagatag

DBGET integrated database retrieval system