KEGG   Sus scrofa (pig): 100156764Help
Entry
100156764         CDS       T01009                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100156764
Transfer RNA biogenesis [BR:ssc03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100156764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 269 aa AA seqDB search
SDFSFLRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENPAFRPD
GLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWTRVYRVQRDIPMPL
VSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGW
ETFLSYEDPDQDILIGLLRLRKCSEETFRFELVGGVSIVRELHVYGSVVPVSSRDPTKFQ
HQGFGMLLMEEAERIAREEHGSGKIAVIS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atagtgacttttcttttctcaggggccacactgtgaaggcagtttgtgagtcatttcacc
tggccaaagattctggtttcaaagttgtggctcatatgatgcctgatctgccaaatgtgg
gacttgaaagagacattgaacagtttacggagttttttgagaaccctgcttttcgtcccg
atggtttgaaactctaccctaccctggtgattcgtggaactgggctttatgagctgtgga
aatcaggaagatacaagagttactctcccagtgacctgatcgaattggtggcccggatcc
tggcccttgtacccccatggactcgagtgtaccgagtacagagagatatcccaatgcctt
tagtgagctcaggagtagagcatggtaacttgagagagctggcatttgcaagaatgaagg
accttggaatacagtgtcgagatgtgagaaccagagaggttggaatccaagaaattcatc
acaaagtacggccataccaggtcgaattggtaagaagagattatgttgcaaatggtggct
gggaaacattcttatcatatgaagatccagatcaagacatcttgattggcctcctgaggt
tacgaaagtgttcagaggaaacattccgcttcgaattggttggaggtgtttccatagtcc
gagagctgcatgtgtatggaagtgtcgtccccgtaagcagtcgggatcccactaaatttc
agcatcagggatttggcatgctgctgatggaggaagcagagaggatagctagagaagaac
atggatctgggaagatagctgttatatcag

DBGET integrated database retrieval system