KEGG   Sus scrofa (pig): 100156917Help
Entry
100156917         CDS       T01009                                 

Gene name
GALC
Definition
galactosylceramidase (EC:3.2.1.46)
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
ssc  Sus scrofa (pig)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ssc00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ssc04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 685 aa AA seqDB search
MAERRLQASRQRRVKVMTAAAGSAGQVAVTLLLCALLAPGSSYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITFIGLPWSFPGWLGKGFNWPYVNLQLTAYYVMTWIV
GAKHYHDLDIDYIGIWNERAFDANYIKVLRRMLNYQGLQQVKIIASDNLWEPISASMLLD
SELMKAIDVIGAHYPGTRTVKDARLTEKKLWSSEDFSTLNNDVGAGCWGRILNQNYINGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYAVEAPIWISAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIVETMSHKHSLCIRPFLPYFNVSHQFATFVLKGSFREI
PELQVWYTKLGKPSKRYLFKQLDSLWLLDSSGSFTLELHEDELFTFTTLTTGNKGSYPPP
PKSQPFPCVYEDDFNVDYPYFSEAPNFADQTGVFEYFMNIEDPGEHRFTLRQVLNQRPIT
WAADAFNTISVIGDYKWSNLTIKCDVYIETSETGGVFIAGRVNKGGILIRSARGVFFWIF
ANGSYQVTGDLAGWIIYTSGYADIKAKKWYTLTLTIKGGSSSGTLNGKLLWKNVSVNFPK
NGWAAIGTHSFEFAQFDNFRVEATC
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgccgactccaggcttcccggcaacgccgggtgaaagtcatgacggctgcc
gcgggttcggcgggccaagtcgcggtgaccctgctgctgtgcgcgctgcttgcgcccggc
agctcgtacgtgctcgacgactctgacgggctgggccgggagttcgacggcatcggagcg
gtcagcggcggcggggcaacctcccgacttctagtaaattacccagagccctatcgttct
caaatactggattatctctttaagccaaacttcggtgcctctttgcatattctaaaagtt
gaaataggtggtgatgggcagacaacagatggcactgagccctcccacatgcactatgca
ttagatgagaattatttccgaggatatgagtggtggttaatgaaggaagctaagaagcgg
aaccctaatattacattcattgggttgccatggtcattccctggatggctggggaaaggt
ttcaactggccttatgtaaatcttcagctgactgcctactatgtcatgacctggattgtg
ggcgccaagcattatcatgatctggatattgattatattgggatttggaatgagagggca
tttgacgccaattatatcaaggtgttaagaagaatgctgaactatcaaggcctccagcaa
gtgaaaatcatagcaagtgataatctctgggagcccatttctgcttctatgctgcttgac
tctgaactcatgaaggcgattgatgtgataggagctcattatcctgggacccgtacagta
aaggatgctaggttgactgagaagaagctttggtcttctgaagattttagcactttgaat
aatgatgtgggtgcaggctgctggggccgcatattgaatcaaaattacatcaatggctac
atgacttccaccattgcttggaatttagtggctagttactatgaacagttgccgtatggg
cgttgtggactgatgactgctcaggagccatggagcgggcactatgcagtagaagctccc
atctggatatcagctcataccactcagtttactcaaccaggttggtattacctgaagaca
gttggccatttagagaaaggaggaagctacgtagccctgactgatggtttaggtaacctc
accatcatcgttgaaactatgagtcataaacattccctatgtataaggccatttcttccc
tatttcaacgtgtcacatcaatttgctaccttcgttcttaaaggttcttttcgtgaaata
ccagagctgcaggtgtggtataccaaacttggaaaaccgtctaagagatatcttttcaaa
caactggattctctatggcttctcgacagcagtggcagtttcacgttagaactgcatgag
gacgagctgttcacattcaccactctcaccactggaaacaaaggcagctacccgccgcct
ccaaagtcccagcccttcccctgtgtctatgaggacgatttcaacgtcgattacccgtat
tttagtgaagctccaaatttcgctgatcagactggcgtgtttgaatattttatgaacatc
gaagaccctggagagcatcgcttcaccctgcgccaggttctcaaccaaagacccatcact
tgggccgctgatgcattcaacaccatcagtgttataggagattacaaatggtccaatctg
actatcaagtgtgatgtgtacatagagacctctgagacgggtggtgtgttcattgccgga
agggtaaataaaggtggtattttgattagaagtgccagaggagttttcttctggattttt
gcaaatggatcctaccaagttacaggtgatctagctggatggatcatatatacttcagga
tatgctgacattaaagcaaaaaaatggtatacactcactttaactattaagggcggttcc
tcctccggcacgctgaatggcaagcttctctggaagaatgtctctgtgaacttcccgaag
aacggctgggccgcaattgggacgcactcctttgaatttgcccagtttgacaacttccgt
gtggaagccacatgctaa

DBGET integrated database retrieval system