KEGG   Sus scrofa (pig): 100157102Help
Entry
100157102         CDS       T01009                                 

Gene name
USP20
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 20
  KO
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100157102 (USP20)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100157102 (USP20)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100157102 (USP20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 915 aa AA seqDB search
MGDSRDPCPHLDSIGEVTKEDLLLKSKGTCQSCGVAGPNLWACLQVSCSYVGCGESFADH
STIHAQVKTHNLTVNLTTFRVWCYACEKEVFLEQRLAAHPPGPLPKFSEQDSPPPPCHPL
KAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNGSPPLTQFFLECGG
LVRTDKKPALCKSYQKLVTEVWHRKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRC
LMDQLHEELKEPRVAAALPEARDSDSSDSDEKREGDRSPSEDEFLSCDSSSDRGEGDGQG
RGGGGSPAETELLIPDEAGRAISEKERRKDRXFSWGQQRTSSEQVDEDADVDTAMAALDQ
QPTDTQPPSPRSTSPCRTPEPDNEAHMRSASRPCSPVHHHEGHAKLAGSPPRASPVRMGP
SYVLKKAQVPSTGSRRRKEQQYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPI
PGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTL
EDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLQLPEILCIHLKRFRHEVMYSFKI
SSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEF
DDQYVTEVHETLVQNAEAYVLFYRKSSEEALRERQQVVSLAAMREPSLLRFYVSREWLNK
FNTFAEPGPITNHTFLCSHGGIPPNKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYV
CSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPSVIYCISMQWFREWEAFVKGKDNEP
PGPIDNSRIAQVKGSGHIQLKQGADYGQISEETWVYLLSLYGGGPEIAIRQSVAQLQDPE
SLHGEQKIEAETRAV
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgggggactccagggacccttgccctcatcttgactctataggggaggtgaccaaagag
gacttgctgctcaaatccaagggcacctgtcagtcgtgcggtgttgcgggacccaacctg
tgggcctgtctccaggtctcttgctcctacgttggctgtggagaatccttcgccgaccac
agcaccatccatgcgcaggtaaaaacgcacaacctgacagtgaacctgaccacgttccgg
gtatggtgttatgcctgtgagaaggaggtgtttctggagcagcggctggcagcccacccg
ccgggccccttgcccaagttctcagagcaggactcgccaccgccaccctgccaccctctg
aaagctgtccccattgctgtggccgacgaaggcgagtccgagtccgaggacgacgacctc
aaacctcgaggcctcacgggcatgaagaacctggggaactcctgctacatgaacgcggcc
ctgcaggcgctgtccaatggtagccccccgctgacgcagtttttcttggagtgtggcggc
ctggtgcgcacagacaagaagccagccctgtgcaaaagttaccagaagctggtcacggag
gtctggcacagaaaacgccccagctacgtggttcccaccagcctgtcccacgggatcaag
ttggtcaacccgatgttccgaggctatgcccagcaggacacccaggagttcctgcgctgc
ctgatggaccagctgcacgaggagctcaaggagcccagggtggcggcggcgctgccggag
gctcgggactcggactcgagcgactcggatgagaagcgggagggcgaccggagcccgtcg
gaggacgagttcctgtcctgcgactccagcagcgaccgaggcgagggcgatgggcagggc
cgtggcgggggcggctcgccggccgagacggagctgctgatcccggacgaggcgggccgc
gccatctccgagaaggaacgcaggaaggaccgcnagttctcctggggccagcagcgcacc
agctcggagcaggtggacgaggacgccgacgtggacaccgccatggccgccctcgaccag
cagcccacggacacgcagccaccgtcgccgcggtccaccagcccctgccggacgccagag
ccggacaacgaggcccacatgcgcagtgcctctcgcccctgcagccccgtccaccaccac
gagggccacgccaagctggccggcagccctccccgcgcgagccccgtgaggatgggtccg
tcgtacgtgctcaagaaagcccaggtaccgagcacaggcagccggcggcggaaggagcag
cagtaccgcagcgtcatctcagacatcttcgatggctccatcctcagcctcgtgcagtgc
ctcacctgcgacagggtgtccaccacggtggagacgttccaggacctgtccctgcccatc
cctggcaaggaggacctggccaagctccactcggccatctaccagaatgtgccggccaag
ccaggggcctgtggggacagctacgccgcccagggctggcttgcctttatcgtggagtat
atccgacggtttgtggtatcctgtacccccagctggttttgggggccagtcgtcaccctg
gaagactgcctggctgccttcttcgctgctgatgagctgaagggtgacaacatgtacagc
tgtgagcggtgtaaaaagctgcgcaacggggtgaagtactgtaaggtcctgcagctgccc
gagatcctgtgcattcacctgaagcgctttcggcacgaggtgatgtattcattcaaaatc
agcagccacgtctccttccccctcgaggggctcgacctgcgccccttcctcgccaaagag
tgcacgtcccagatcaccacctacgacctcctctccgtcatctgccaccacggcacggca
ggcagtggtcactacatcgcctactgccagaacgtgatcaacgggcagtggtacgagttc
gacgaccagtacgtgaccgaggtccacgagacgctggtgcagaacgccgaggcctacgtg
ctcttctacaggaagagcagcgaggaggccttgcgggagcgccagcaggtggtgtccctg
gccgccatgcgggagcccagcctgctgcggttctacgtgtcccgggaatggctcaacaag
ttcaacaccttcgccgagccggggcccatcaccaaccacaccttcctctgctcccacgga
ggcatcccgcccaacaaataccactacatcgacgacctggtggtgatcctgccccaaaac
gtctgggagcatctgtacaacaggtttgggggcggccctgccgtgaaccacctgtacgtg
tgctccatctgccaggtggagatcgaggcgctggccaagcgcaggcggatcgagattgac
accttcatcaagctgaacaaggcgttccaggccgaggagtcgcccagcgtcatctactgc
atcagcatgcagtggttccgggagtgggaggcctttgtcaaggggaaggacaacgagccc
cccgggcccattgacaacagcaggatcgcccaggtcaaaggcagcggccacatccagctg
aagcagggagctgactacgggcagatctcagaggagacctgggtgtacctgctcagcctg
tacggcggcggccccgagatcgccatccgccagagcgtggcccagctccaggacccggag
agcctacacggggagcagaaaatcgaagctgagacgcgggccgtgtga

DBGET integrated database retrieval system