KEGG   Sus scrofa (pig): 100157221Help
Entry
100157221         CDS       T01009                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100157221 (RASGRF1)
   04010 MAPK signaling pathway
    100157221 (RASGRF1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100157221 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1257 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPTLSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQPVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEDPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTAVVVLDKLITIYRKPISAIPARSLELLFASGQNNKLLYGDPPKSPRATRK
FSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKAT
LDTSKLYVSSSFASKIPDEGDTTAEKPEEPSALRKQSSEISMREESDNDQNQSDDGDAET
SPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEG
TPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELK
CKVISFLEEVMHDPELLTQERKAAANIIRTLTQDDPGDNQITLEEITQLAEGVKAEPFEN
HSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASE
IIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTK
ALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFS
KMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaacgatggccacgtcgcgtccctgggactgctggcacgc
aaggacggcacgcgcaaaggctacctaagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccatcggggctctacctgctggagggctgcgtctgcgaccgggcgccctcccccaag
cctacgctctcagccaaggagccactggagaaacagcattacttcaccgtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggacgccaaggattgcgacgaatgg
gtggcggccattgctcacgccagctaccggaccctggccacagagcatgaggcactgatg
cagaagtacctgcacctgctgcagatcgtggagaccgagaagacggtggccaagcagcta
cgacagcagatcgaggatggggagatcgagattgagcggctgaaggcagagatcgcgtcc
ctgctcaaggacaatgagcgcatccagtccacccagcccgtcacccccaatgatgaagac
agtgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgc
aagtggaagaccatcatccaggactacatccggtcgccgcacgccgacagcatgcggaaa
aggaaccaggtggtgttcagcatgctggaggccgaggccgagtacgtgcagcagctgcac
atcctggtcaacaacttcctgcgcccgctgcgcatggctgccagctccaagaagccgccc
atcacgcacgacgatgtcagcagcatcttcctgaacagtgagaccatcatgtttttgcac
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccactctggtcctggcc
gacctgttcgacatcctgctgcccatgctcaacatctaccaggagtttgtccgcaaccac
cagtacagcctgcagatccttgcccactgcaaacagaaccgcgactttgacaagctgctg
aagcactacgaggccaagcccgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatcctgacgctgcacgagctcctggcccacacccct
catgagcatgtggagcgcaacagcctggactacgccaagtccaaactggaggaactgtcc
aggataatgcatgatgaagtaagcgaaacagagaacatccgaaaaaacctggccattgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagaccttcgtcagacaa
ggttccctcatccaggtgcccatgtccgaaaagggcaagatcacccggggtcgcctgggt
tctctgtccctaaagaaagagggtgagcggcagtgcttcctgttttctaagcatctgatc
atctgtaccagaggctctggcgggaagcttcacctgaccaagaatggagtcatatccctc
attgactgcaccttgttggaggacccagaaagcacggaggaagaagccaaaggatccggc
caagacattgaccacttggattttaagatcggggtggagcccaaggactccccgcccttc
acagtcatcctcgtggcctcatccaggcaggagaaggcggcctggaccagtgacatcagc
cagtgcgtggataacatccggtgcaacgggctcatgatgaacgcgtttgaggaaaattcc
aaggtcactgtgccgcagatgatcaagtccgacgcctccttgtattgtgatgacgtggac
attcgcttcagcaaaaccatgaactcctgcaaagtcctgcagatccggtacgccagcgtg
gagcggctgctggagaggctcacggacctgcgcttcctgagcatcgacttcctcaacacc
ttcctgcactcctaccgcgtcttcaccacggccgttgtggtcctggacaagctcatcacc
atctacaggaagcccatcagcgccatccccgccaggtcactggagctcttgttcgccagc
ggccagaacaacaagctcctgtacggggacccccccaagtccccacgagccacccgcaag
ttctcctcgccgccacccctgtccatcaccaagacgtcgtcacccagccgccggcggaag
ctctccctgaatatccccatcatcacgggcggcaaggccctggacctggccgccctcagc
tgcaactccaacggctacaccagcatgtactcggccatgtcgcctttcagcaaggccacc
ctggacaccagcaagctctacgtgtccagcagctttgccagcaagattccagatgagggc
gatacgaccgctgagaagcctgaagaaccctcagctctcagaaagcagagctcagaaatc
tccatgagggaagagtcagataacgaccaaaaccagagtgacgatggtgacgccgagact
tcaccaaccaagtctccgaccacaccaaaatcggtcaaaagcaaaaactcctcagagttc
ccgctcttttcctacaataatggagtcgtcatgacctcctgtcgcgagttggacaataac
cgcagtgccctgtcagcagcgtccgcctttgccatagcgactgcgggcgccaacgagggc
accccaaacaaggagaagtatcggaggatgtccttagccagtgcagggtttccacccgac
cagaggaacggagacaaggagtttgtgatccgcagagcggccaccaatcgcgtcctgaac
gtgctccgccactgggtctccaagcattctcaggactttgagaccaacgacgagctcaaa
tgcaaggtgatcagcttcctggaggaggtcatgcacgacccagagctactgacccaggag
cggaaggctgcggccaacatcatcaggactctgacccaggatgacccaggcgacaaccag
atcacgctggaggagatcacacagctggctgaaggcgtgaaggccgagccctttgaaaac
cactctgccctggagatcgcggagcagctgaccctgctggaccacctcgtcttcaagaag
atcccttatgaggagttctttggacaaggctggatgaaactggaaaagaacgaaaggacc
ccttacatcatgaaaaccaccaagcatttcaacgatatcagcaacctgattgcttccgaa
atcatccgcaatgaggacatcaacgcgagggtgagcgccattgagaagtgggtggctgtg
gcggacatatgccgctgcttacacaactacaatgctgttctggagatcacctcgtccatg
aaccggagtgcaatcttccgactgaaaaagacgtggctcaaagtatctaagcagacaaaa
gctttgattgataagctccaaaagcttgtgtcatcagagggcagatttaagaatctgaga
gaagctctgaaaaattgtgacccaccgtgtgtcccttacctggggatgtacctcaccgac
ctggccttcatcgaagaggggacgcccaactacacggaggacggcctggtcaacttctcc
aagatgagaatgatatcccatattatcagagagattcgccagtttcaacaaacagcctac
aaaatagagcaccaagcaaaggtaacccagtatttactggaccagtcttttgtaatggat
gaagaaagcctctacgagtcttctctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system