KEGG   Sus scrofa (pig): 100157514Help
Entry
100157514         CDS       T01009                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100157514 (GTF3C4)
Transcription machinery [BR:ssc03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100157514 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 820 aa AA seqDB search
MNTADKARVGPAADRPAPPEEEEGEAGGKGPVADPAPGPSAAFRLLVTRREPAVRLQYAV
SGLEPLAWSEDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKVGSKT
EVAECKEKFATSKDPTISQTFMLDRVFNPEGKALPPLRGFKYTSWSPMGCDANGRCLLAA
LTMDNRLTVQANLNRLQWVQLADLTEIYGERLYETSYRFSKSEAPQGSLGDFAEFQRRHS
MQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVGKESISSCN
TIESGITSPSVLFWWEYEHSNRKMSGLIVGSAFGPVKILPVNLKAVKGYFTLRQPVVLWK
EMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTGLHSL
PIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLADVFGSVRTHGIAVSP
CGAYLAVITTEGMVNGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFKQVDLIDLVR
WKILKDKHIPQFLQEALEKKMESSGATYYWRFKLFLLRILYQSMQKTPEALWKPTHEDSK
ILLVDSPGMGNAEDEQQDEGTSSKPVNKPGLQERSKEGDAEDAAAAAAESPTQAGDTGGR
EPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDEEY
DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQS
LIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggccgacaaggcccgggtggggcccgcggccgaccggcctgcgccgcccgag
gaagaagagggcgaggcgggcgggaaggggccggtggcggacccggcccccgggcccagc
gccgcgttccgcctcctggtgactcggcgggagccggccgtgaggctgcagtatgcggtg
agcggcctggagccgctggcgtggtccgaggaccaccgcgtgtcggtgtccaccgcccgt
agcatcgctgtgctggagctcatctgcgacgtgcacaacccgggccaggacctggttatc
caccgcacctccgtgcccgcgcctctcaacagctgcctcctcaaagttggctcaaaaaca
gaagttgctgagtgcaaggagaaatttgccacctctaaggaccccacaatcagtcagacg
ttcatgctggatagggtgttcaaccctgaggggaaggctctgcccccgctgagagggttc
aagtacaccagctggtcccccatgggttgtgacgcgaacggcaggtgcctcttggcagca
ctgaccatggacaaccgcctgaccgtccaggccaacctcaacagactgcagtgggtccag
ctggccgacctgacggagatttacggggaacgcctttacgagaccagttacaggttctct
aaaagtgaggccccgcaggggagcctcggcgattttgctgagtttcagaggaggcacagc
atgcagacccccgtcaggatggagtggtcgggcatctgcaccacgcagcaggtcaagcac
aacaacgagtgccgcgacgtgggcagcgtgctcctggcagtcctcttcgaaaacggcaac
atcgccgtgtggcagttccagctcccgtttgtaggaaaggagtctatctcttcgtgcaac
acgattgagtcaggaatcacctctcctagcgttttgttttggtgggagtacgagcacagc
aaccggaaaatgagcggccttattgtggggagtgctttcggacctgtaaaaattcttccc
gtcaacctcaaagccgtcaagggctacttcaccttgaggcagcccgtcgtcttgtggaag
gaaatggaccagctgccggttcacagcatcaagtgcgtgccgctctatcacccctaccag
aagtgtagctgtagcctcgtggtggccgcgagaggatcctacgtgttttggtgtcttctt
ctcatctccaaagcgggtctgaatgttcacaattcccacgtcacaggcctccactcgctg
cccatcgtctccatgacggcggacaagcagaacgggacggtctacacctgctccagtgac
gggaaggtgcggcagctgattcccatcttcacggacgtggccttgaagttcgaacaccag
ctgattaagctggcggacgtattcggctccgtgaggacacacgggatcgcagtgagcccc
tgcggcgcgtacctggccgtcattacaacggagggcatggtcaacggcctccaccccgtg
aacaaaaactaccaggttcagttcgtgaccctcaaaacctttgaggaggcagcggctcag
cttctggaatcttcagttcagaatctctttaagcaggttgatttaatagacctggtgcgc
tggaagattttaaaagataaacacatcccgcagtttttacaagaggctttggaaaaaaag
atggaaagcagcggggccacctattattggcgtttcaaactcttcctcctgaggattttg
tatcagtcgatgcagaaaactccagaagccttatggaaacccacccacgaggactcgaaa
atcttactcgttgactcacctgggatgggcaacgccgaggacgaacagcaagacgaaggc
acgtcctccaaaccggtgaacaagccaggcctccaggagcggagcaaagaaggagacgca
gaggacgcggcggcggcggcggcggagtcgcccactcaggccggggacaccggaggccgc
gagcccatggaggagaagctcctcgagatccaagggaagatcgaagctgtggaaatgcac
ctgacccgggagcacatgaagcgcgtcctgggcgaagtctacctgcacacctggatcaca
gaaaacactagcatccccaccaggggactctgcaacttcttaatgtcggatgaagagtac
gacgaccggacagcccgggtgctcatcggacacatctccaagaagatgaacaagcagacg
ttccctgagcactgcagcttgtgtaaagagatcctgcccttcacagatcgcaagcaggcc
gtctgctccaatggccacatttggctccggtgctttttaacctaccagtcctgccagagt
ttgatatacagaaggtgtttgctccatgacagcattgcccgccacccagctccagaagat
cctgactggattaagaggttactgcaaagcccctgccccttctgcgattctcctgtcttc
tga

DBGET integrated database retrieval system