KEGG   Sus scrofa (pig): 100157546Help
Entry
100157546         CDS       T01009                                 

Gene name
USP8
Definition
(RefSeq) ubiquitin specific peptidase 8
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100157546 (USP8)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100157546 (USP8)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100157546 (USP8)
Membrane trafficking [BR:ssc04131]
 Endosome - Lysosome transport
  Others
   Others
    100157546 (USP8)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100157546 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1087 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKNYVQSALKIFKTAEESRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFLSILGPGNIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEKEQLQRQKRQEAGIEDGGTSAKSSLESVLDSKDKTRKINGEKSEKNETTEK
GAITAKELYTMMMDKNISLIIMDARRMQDYQDSHILNCLSVPEEAISPGVTASWIEANLP
DDSKDTWKKRGSVDYVVLLDWFSSAKDLQLGTILRSLKDALFKWESKTVLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRGKNEEVSISLNFTYPSLEESLPSKPTAQMSRPIEVNES
IELTNNQNERVGPLNIPIPVEPIAASKSDVSPIIQPVPTVKIVPQIDRTKKPAVKLPEDH
RVKSESTDHEQQSPQDGRVVPDRSTKPIFPPPTAMLTDEEKARIHAETALLMEKNKQEKE
LRERQQEEQKEKLRKEEEEQKDRKKQEAEENEITEKQQNAKEQMEKRESEQAKKEDKETS
AKKGREITGVKRQSKSEHETTDAKKSVEDRGKRCPTPEMQKQSAGDIPHASVAGDSGSGK
TREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPS
TPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRRPTVTPTVNRENKPTSYPK
AEITRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQ
EDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQE
LLLFLMDGLHEDLNKADNRKRHKEENNDHLDDFKAAEYAWQKHKQLNESIIVALFQGQFK
STVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRAR
RDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLAQYVIGPKNNLKKY
NLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISISSVKSSAAYILFYTSLGP
RVTDVAT
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcctaaagaactctacctcagttcttcactaaaagacctc
aataagaagacagaagttaaaccagagaaaataagcactaagaattatgtacagagtgcc
ctgaagatcttcaagactgcggaagaaagcagattagatcgtgatgaggaaagggcctat
gtgctatatatgaaatatgtgactgtttataatcttatcaaaaaaaggcctgatttcaag
caacagcaggactactttctttcaatacttggacctggaaacatcaaaaaagctattgaa
gaagctgaaagactctctgaaagccttaaactcagatatgaagaagctgaagttcggaaa
aaacttgaagaaaaagacagacaggagaaagagcagctgcagagacagaaaaggcaggaa
gcaggaattgaggatggtggcacatcagcaaaaagttctttggaaagtgtattggattcc
aaagacaaaacccgaaagataaatggtgaaaagagtgaaaaaaatgaaactacagagaaa
ggagcaatcacagcaaaggagctatacacaatgatgatggataaaaacatcagcttgatt
ataatggatgctcgaagaatgcaagattatcaggattcccatattttaaattgtctcagt
gttcctgaagaagccatcagtccaggagtcactgctagttggattgaagcaaacctccca
gatgattctaaagacacatggaagaagagggggagtgtggattatgtggtacttcttgac
tggtttagttctgccaaagatttgcaacttggaacaattctgcggagtctgaaagatgca
cttttcaagtgggaaagtaaaactgtcctgcgcaatgagcctttggttttagaaggaggc
tatgaaaactggctcctttgttatccacagtatacaacaaatgctaaagtcactccaccc
ccacgaggcaagaatgaagaggtgtctatctcattgaattttacctacccctcactggaa
gaatcacttccttcaaaacctactgcccagatgtcacgtcctatagaagtcaatgaaagt
atagaattgacaaacaatcaaaatgagagagtgggaccactaaatataccaattccagtt
gaaccaattgctgcttccaaatctgatgtttcacccataattcagccagtgcctactgta
aagattgttccacagattgatcgtactaaaaaaccagcagtcaaattgcctgaagatcat
agagtaaaatctgaaagtacagatcatgagcaacagtctccccaggatggaagagttgtt
cctgatcgttccacaaaaccaatattcccccctccaactgccatgttaacagatgaagaa
aaagctcgtattcatgcagaaactgcacttctaatggagaaaaacaaacaagaaaaagaa
cttagagaaaggcagcaagaggaacagaaagagaaactgagaaaggaagaagaagaacaa
aaagacagaaagaaacaggaagctgaagaaaatgaaatcacagagaagcaacaaaatgca
aaagagcaaatggaaaagagagaaagtgaacaggccaagaaagaagataaagaaacctca
gcaaagaagggcagagaaataacaggagtaaaaagacaaagtaaaagtgaacatgaaact
actgatgccaagaaatctgtggaagatagggggaagaggtgtccaaccccagaaatgcag
aaacagtcagcaggagatataccccatgcttctgtggcaggagattcgggttcaggcaag
actcgagagcctttgacaagagcacgaagtgaagaaatggggaggatcgtaccaggactg
ccttcaggctgggctaagtttcttgatcccatcactggaacttttcgttactatcattca
cccaccaatactgttcatatgtatccaccggaaatggctccttcatctgcgcctccttcc
acccctccaactcataaagccaagccacagatacctgctgagcgggacagggaaccatcc
aaactgaagcgctcctactcctccccagatataacccaggccatccaagaggaagagaag
aggaggccaacagtgacaccaacagttaatcgggaaaacaagccaacaagctaccctaaa
gctgagatcacaaggctttctgcttctcagattcgaaacctgaatcctgtttttggagga
tctggaccagctctcactggacttcgtaatttaggaaatacttgttacatgaactcaata
ctccagtgcctatgtaatgctccacatttggctgattatttcaaccgcaactgttatcag
gaagatattaataggtcaaatttgttgggacataaaggtgaagtagcagaagaatttggc
ataatcatgaaagccctgtggacaggacagtacaggtatatcagtccaaaagacttcaaa
atcaccattggcaagatcaatgaccaatttgctggatacagccagcaagattcacaagaa
ctgcttctgttcctgatggatggtctccatgaagatcttaataaagctgataatcggaag
agacataaagaagaaaataatgatcatcttgatgactttaaagctgcagaatatgcttgg
cagaaacacaagcagctcaatgaatctatcattgttgcactttttcagggtcagtttaaa
tccacagtacagtgcctcacttgtcacaaaaagtctaggacatttgaggccttcatgtat
ttgtctctaccactagcatctacaagtaaatgtacattacaggattgccttagattattt
tccaaagaagaaaaactcacagataacaacaggttttactgcagtcattgcagagctcga
cgggattccctaaaaaagatagaaatctggaagttgccacctgtacttttagtgcatctg
aaacgtttttcctatgatggtaggtggaagcaaaaattacagacatctgtggacttcccg
ttagaaaatcttgacttggcacagtatgttattggtccaaagaacaatttaaagaaatac
aatttattttctgtttcgaatcactatggtggactggatggaggtcactacactgcctat
tgtaaaaatgcagcaagacagcgatggtttaaatttgatgatcacgaagtttctgatatc
tccatttcttctgtgaaatcttcagcagcttatatcctcttttatacgtcattgggacca
cgagtaactgatgttgccacataa

DBGET integrated database retrieval system