KEGG   Sus scrofa (pig): 100157546Help
Entry
100157546         CDS       T01009                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100157546 (USP8)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100157546 (USP8)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100157546 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1117 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKNYVQSALKIFKTAEESRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFLSILGPGNIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEKEQLQRQKRQEAGIEDGGTSAKSSLESVLDSKDKTRKINGEKSEKNETTEK
GAITAKELYTMMMDKNISLIIMDARRMQDYQDSHILNCLSVPEEAISPGVTASWIEANLP
DDSKDTWKKRGSVDYVVLLDWFSSAKDLQLGTILRSLKDALFKWESKTVLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRGKNEEVSISLNFTYPSLEESLPSKPTAQMSRPIEVNES
IELTNNQNERVGPLNIPIPVEPIAASKSDVSPIIQPVPTVKIVPQIDRTKKPAVKLPEDH
RVKSESTDHEQQSPQDGRVVPDRSTKPIFPPPTAMLTDEEKARIHAETALLMEKNKQEKE
LRERQQEEQKEKLRKEEEEQKDRKKQEAEENEITEKQQNAKEQMEKRESEQAKKEDKETS
AKKGREITGVKRQSKSEHETTDAKKSVEDRGKRCPTPEMQKQSAGDIPHASVAGDSGSGK
LVKIKGQPESGILKTGTFRENTEDTERNKVSSEPLTRARSEEMGRIVPGLPSGWAKFLDP
ITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSPD
ITQAIQEEEKRRPTVTPTVNRENKPTSYPKAEITRLSASQIRNLNPVFGGSGPALTGLRN
LGNTCYMNSILQCLCNAPHLADYFNRNCYQEDINRSNLLGHKGEVAEEFGIIMKALWTGQ
YRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRHKEENNDHL
DDFKAAEYAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSK
CTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWK
QKLQTSVDFPLENLDLAQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWF
KFDDHEVSDISISSVKSSAAYILFYTSLGPRVTDVAT
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcctaaagaactctacctcagttcttcactaaaagacctc
aataagaagacagaagttaaaccagagaaaataagcactaagaattatgtacagagtgcc
ctgaagatcttcaagactgcggaagaaagcagattagatcgtgatgaggaaagggcctat
gtgctatatatgaaatatgtgactgtttataatcttatcaaaaaaaggcctgatttcaag
caacagcaggactactttctttcaatacttggacctggaaacatcaaaaaagctattgaa
gaagctgaaagactctctgaaagccttaaactcagatatgaagaagctgaagttcggaaa
aaacttgaagaaaaagacagacaggagaaagagcagctgcagagacagaaaaggcaggaa
gcaggaattgaggatggtggcacatcagcaaaaagttctttggaaagtgtattggattcc
aaagacaaaacccgaaagataaatggtgaaaagagtgaaaaaaatgaaactacagagaaa
ggagcaatcacagcaaaggagctatacacaatgatgatggataaaaacatcagcttgatt
ataatggatgctcgaagaatgcaagattatcaggattcccatattttaaattgtctcagt
gttcctgaagaagccatcagtccaggagtcactgctagttggattgaagcaaacctccca
gatgattctaaagacacatggaagaagagggggagtgtggattatgtggtacttcttgac
tggtttagttctgccaaagatttgcaacttggaacaattctgcggagtctgaaagatgca
cttttcaagtgggaaagtaaaactgtcctgcgcaatgagcctttggttttagaaggaggc
tatgaaaactggctcctttgttatccacagtatacaacaaatgctaaagtcactccaccc
ccacgaggcaagaatgaagaggtgtctatctcattgaattttacctacccctcactggaa
gaatcacttccttcaaaacctactgcccagatgtcacgtcctatagaagtcaatgaaagt
atagaattgacaaacaatcaaaatgagagagtgggaccactaaatataccaattccagtt
gaaccaattgctgcttccaaatctgatgtttcacccataattcagccagtgcctactgta
aagattgttccacagattgatcgtactaaaaaaccagcagtcaaattgcctgaagatcat
agagtaaaatctgaaagtacagatcatgagcaacagtctccccaggatggaagagttgtt
cctgatcgttccacaaaaccaatattcccccctccaactgccatgttaacagatgaagaa
aaagctcgtattcatgcagaaactgcacttctaatggagaaaaacaaacaagaaaaagaa
cttagagaaaggcagcaagaggaacagaaagagaaactgagaaaggaagaagaagaacaa
aaagacagaaagaaacaggaagctgaagaaaatgaaatcacagagaagcaacaaaatgca
aaagagcaaatggaaaagagagaaagtgaacaggccaagaaagaagataaagaaacctca
gcaaagaagggcagagaaataacaggagtaaaaagacaaagtaaaagtgaacatgaaact
actgatgccaagaaatctgtggaagatagggggaagaggtgtccaaccccagaaatgcag
aaacagtcagcaggagatataccccatgcttctgtggcaggagattcgggttcaggcaag
cttgttaagattaaaggacagccagaaagtggaattctaaaaactggaacttttagagag
aatacggaagacaccgaaagaaataaagtaagcagtgagcctttgacaagagcacgaagt
gaagaaatggggaggatcgtaccaggactgccttcaggctgggctaagtttcttgatccc
atcactggaacttttcgttactatcattcacccaccaatactgttcatatgtatccaccg
gaaatggctccttcatctgcgcctccttccacccctccaactcataaagccaagccacag
atacctgctgagcgggacagggaaccatccaaactgaagcgctcctactcctccccagat
ataacccaggccatccaagaggaagagaagaggaggccaacagtgacaccaacagttaat
cgggaaaacaagccaacaagctaccctaaagctgagatcacaaggctttctgcttctcag
attcgaaacctgaatcctgtttttggaggatctggaccagctctcactggacttcgtaat
ttaggaaatacttgttacatgaactcaatactccagtgcctatgtaatgctccacatttg
gctgattatttcaaccgcaactgttatcaggaagatattaataggtcaaatttgttggga
cataaaggtgaagtagcagaagaatttggcataatcatgaaagccctgtggacaggacag
tacaggtatatcagtccaaaagacttcaaaatcaccattggcaagatcaatgaccaattt
gctggatacagccagcaagattcacaagaactgcttctgttcctgatggatggtctccat
gaagatcttaataaagctgataatcggaagagacataaagaagaaaataatgatcatctt
gatgactttaaagctgcagaatatgcttggcagaaacacaagcagctcaatgaatctatc
attgttgcactttttcagggtcagtttaaatccacagtacagtgcctcacttgtcacaaa
aagtctaggacatttgaggccttcatgtatttgtctctaccactagcatctacaagtaaa
tgtacattacaggattgccttagattattttccaaagaagaaaaactcacagataacaac
aggttttactgcagtcattgcagagctcgacgggattccctaaaaaagatagaaatctgg
aagttgccacctgtacttttagtgcatctgaaacgtttttcctatgatggtaggtggaag
caaaaattacagacatctgtggacttcccgttagaaaatcttgacttggcacagtatgtt
attggtccaaagaacaatttaaagaaatacaatttattttctgtttcgaatcactatggt
ggactggatggaggtcactacactgcctattgtaaaaatgcagcaagacagcgatggttt
aaatttgatgatcacgaagtttctgatatctccatttcttctgtgaaatcttcagcagct
tatatcctcttttatacgtcattgggaccacgagtaactgatgttgccacataa

DBGET integrated database retrieval system