KEGG   Sus scrofa (pig): 100157649Help
Entry
100157649         CDS       T01009                                 

Gene name
TTK
Definition
TTK protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100157649 (TTK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100157649 (TTK)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100157649 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 854 aa AA seqDB search
MEAEDLGGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKVSADTTDNSGTVNQMMMMAN
NPEDWLNLLLKLEKNSVPLNDALLNKLIGRYNQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNFKKSKQLLHKAVECGAVPLEML
EVAIRNLNLQKKQLLSEEEKKSLSAPTVSNVQEPFSSTLGHLQNRNISCDSRGQTAKARF
LYGXENXIQSLNACHMFILXXXSKTFSGMSIXRVPVNLLSSPDYHEKMDGPVVPTFTKRQ
FSGSECRDAVVPGTKSSGNDSSELRSLKSVQNIRSKEPLMTDEKSSKIITDSITLKNKNE
SSLLTKLEETKEHQEPKIPESNQKYWQSKNKLENQNPDASSNQWQMPEMIQKVDTEPKQT
TFEQPAFSVSKQSPPISAPKWIDPKSICKTPSSSALDDYMSCFRTPVVKNDFPPACQLST
PYSQLACFQQQQQQIPVTPLQNLQISASSSNECISVKGKIYSILKQIGSGGSSKVFQVLN
EKKQIHAIKYVNLEEADSQTIDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMEC
GNIDLNSWLKKKKSINPWERKSYWKNMLEAVYTIHQHGIIHSDLKPANFLIVDGMLKLID
FGIANQMQPDTTSIIKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCIL
YYMTYGKTPFQHIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLIRDPKKRISIPE
LLAHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGESHDS
SSSSETLGKKWGKK
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgaggatttaggtggcagagaattgacaattgattccataatgaacaaagtg
agagatataaaaaataaatttaaaaatgaagaccttactgatgagctaagcttgaataaa
gtctctgctgatactacagataactcaggaactgttaaccaaatgatgatgatggcaaac
aatccagaggactggttgaatttattgctcaaactagagaaaaacagtgtccctttaaat
gatgcccttttaaataaattgattggccgttacaatcaagcaattgaagcacttcctcca
gataaatacggccagaatgagagttttgctagaattcaagtgagatttgctgaactaaaa
gcgattcaagagccagatgatgcacgtgactactttcagatggccagagcaaactgcaag
aagtttgcttttgtgcatatatcttttgcacagtttgagctctcacaaggtaatttcaaa
aaaagtaagcaacttcttcataaagctgtagaatgtggggcagtgccactagaaatgcta
gaagttgccattcggaatttaaacctccaaaaaaagcagctactttcagaggaggaaaag
aagagtttatcagcacccacagtatcaaatgtgcaggaaccattctccagtacacttggg
catttacagaataggaacatcagctgtgattccaggggacagactgctaaagccaggttt
ttgtatgggtaagaaaactgaatccagtctttaaatgcttgtcatatgtttatattannn
nnnnnttccaaaacattttcaggcatgtccatttgaagagtcccagttaaccttctaagt
agcccagattatcatgagaagatggatggtccagtggtaccaacttttactaaaagacag
ttctctggatcagaatgccgagatgcagttgtgcctggaactaaatcaagtggaaatgat
tccagtgaactgagaagtttaaagtctgttcaaaatattcgttccaaggaacctctgatg
acagatgagaagagttctaaaattattactgattcaataactctgaagaataaaaatgaa
tcaagtcttctaacaaaattagaagaaactaaagaacatcaagaaccaaagattccagaa
agtaaccagaaatattggcaatctaagaacaagttggaaaaccagaatcctgatgcatct
tcaaatcagtggcaaatgccagagatgatccaaaaagttgatacagagccaaaacaaacc
acttttgagcaacctgccttttcagtttcaaagcagtcaccgccaatatcagcacctaag
tggattgacccaaaatctatttgtaagacacccagcagcagtgccttggatgattacatg
agctgttttagaactccggttgtaaagaacgactttccacctgcttgtcagttgtcaaca
ccctatagccaacttgcctgtttccagcaacaacagcagcaaatacccgttactccactt
cagaatttacagatttcagcatcctcttcaaatgaatgtatttcagttaaagggaaaata
tattccatactgaagcagataggaagtggaggttcgagtaaggtatttcaggtgttgaat
gaaaagaaacagatacatgctataaagtatgtgaacttagaagaagcagacagccaaaca
attgatagttaccggaatgaaattgcttatctgaataaactacaacagcacagtgataag
atcatccgactttatgattacgaaatcacagaccagtacatctacatggtaatggagtgt
ggaaatattgatctcaatagttggcttaaaaagaagaaatctatcaatccatgggaacgc
aagagttactggaaaaatatgttggaggcagtttacacaattcatcaacatggtatcatt
cacagtgatctgaaacctgctaactttctgatagttgatgggatgctaaagctaattgat
tttgggattgcaaaccaaatgcaaccagatacaacaagtatcattaaagactctcaggtc
ggtacagttaattatatgccaccagaagcaatcaaagatatgtcttcctcaagagagaat
gggaaatccaaatcaaagataagccccaaaagtgatgtttggtccttgggttgcattttg
tactatatgacttacgggaaaacaccatttcagcatataattaatcagatttctaaatta
catgccataattgaccctaatcatgaaattgaatttcctgatattccagagaaggatctt
caagatgtattaaagtgttgtttaataagagatcctaaaaagaggatatccatccctgag
cttctggcacatccatatgttcagattcaaactcatccaggtaaccaaatggctaaggga
accactgaagaaatgaaatatgtcctgggccaacttgttggcctgaattctcctaactcg
attttgaaagctgctaaaactttgtatgagcactatagtggtggtgaaagtcacgattcc
tcttcatcatccgagactttgggaaaaaaatgggggaaaaaatga

DBGET integrated database retrieval system