KEGG   Sus scrofa (pig): 100170147Help
Entry
100170147         CDS       T01009                                 

Gene name
ALPL, ALP
Definition
(RefSeq) alkaline phosphatase, liver/bone/kidney
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100170147 (ALPL)
   00790 Folate biosynthesis
    100170147 (ALPL)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100170147 (ALPL)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100170147 (ALPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
 Enzymes
  100170147 (ALPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 363 aa AA seqDB search
MFLGDGMGVSTVTAARILKGQLHHKPGEETRLEMDKFPYVALSKTYNTNAQVPDSAGTAT
AYLCGVKANEGAVGVSAATQRTQCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPS
AAYAHSHSHYIWNRTELLALDPHTVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVEMAIR
ILIKNPKGFFLLVEGGXXDHGHHEGKAKQALHEAVEMDRAIEQAGSMTSVEDTLTVVTAD
HSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGRENVSMVDYAHDNYQAQSAVPL
RHETHGGELLHGVHEQNYIPHVMAYAACIGANRDHCASASSSGSPSPGPLLLLLAFLPLG
ILF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgggagacgggatgggcgtctccacggtgacagccgcccgcatcctcaagggt
cagctccaccacaaacccggggaggagaccaggctggagatggacaagtttccctatgtg
gccctgtccaagacatacaacaccaacgctcaggtccctgacagcgcgggcaccgccact
gcctacctgtgcggggtgaaggccaatgagggggccgtgggggtgagcgcagccacccag
cgcacccagtgcaacaccactcagggcaacgaggtcacatccatcctgcgctgggcgaag
gacgcagggaaatctgtgggcatcgtgaccaccacgcgagtgaaccatgccacccccagc
gccgcctatgcccactctcactctcactatatctggaaccgcactgaactcctggctctc
gacccccacaccgtggactacctcttgggtctctttgagccgggggacatgcagtatgag
ctcaaccggaacaacgtgacggacccctcgctctccgagatggtggagatggccatcagg
atcctgatcaagaaccccaaaggcttcttcttgctggtggaagggggcagnnttgaccat
gggcaccatgagggcaaagccaagcaggcgctgcacgaggcggtggagatggaccgggca
atcgagcaggcgggctccatgacctccgtggaagacacactgaccgtcgtcactgctgac
cactcccacgtctttacctttggcgggtacaccccccgtggcaactctatctttggtctg
gcccccatggtgagcgacacggacaagaaacccttcactgccatcctgtacggcagagag
aacgtctccatggtggactatgcgcacgacaactaccaggcacagtccgccgtgcccctg
cgccacgagacccacggcggggagctgctgcacggcgtccacgaacagaactacatcccc
cacgtgatggcttacgcagcctgcattggtgccaaccgcgaccactgtgcctcagccagc
tcgtcgggcagcccctccccaggccccctgctgctcctgctggcctttctccccctaggc
atcttgttctga

DBGET integrated database retrieval system