KEGG   Sus scrofa (pig): 100187735Help
Entry
100187735         CDS       T01009                                 

Gene name
USP19
Definition
ubiquitin specific peptidase 19 (EC:3.1.2.15)
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100187735 (USP19)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100187735 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 1341 aa AA seqDB search
MSGGASTTGPRRGPLGLEEATSKKKQKDRANQESKDGDPRRGGSASAPQEEHTKEEVHGD
PHNLFGTPSTELLLDWRQSSDEVIVKLRVGAGPLRLDEVDAAFTDTDCVVRLPGGRQWGG
VFYAEIDGSCTKVQARKGGLLQLSLPKKVPMLMWPSLLKKPLGTQELVPGLRCQENGQEA
SPIASEPGPEPRRAKQEARNQKRAQGRSEAGTGAGPGAQAGPSAKRAVHLRRGPEGEGSR
DGPGPRGDAPPFLAEPASTQAEAEEQLRVPPLNPQTCLLGSEEDLELLTGEKAVSARNDP
VSPAMARSRDPEKGDRSKEEMAVAADAATLVDEPESMVNLAFVKNDSYEKGPDSVVVHVY
VKEIRRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFC
FTASRIDICLHKRQSQRWGGLEAPAARGAVGGAKVAVPTGPTPLDSTPPGSAPHPLTGQE
EARGVEKEKPKARSEDTGLDGVAARTPMEHVTPKPEPHLASPKPTCMVPPMPHSPVSGDS
VEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPL
GTGGRLAIGFAVLLRALWKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGL
HEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCA
KVSITFDPFLYLPVPLPQKQKVLPVFYFAREPHSKPIKFLVSISKENSSASEVLDSLSQS
VHVKPENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTLLCFELLSPELAKERVVVLEVQQR
PQVPSIPISKCAACQRKQQSEDEKLKRCTRCYRVGYCNQLCQKTHWPDHKGLCRPENIGY
PFLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQGPGCTTMLSTSSLEA
GDSERDPVQPPELQLVTPVAEGDTGVPRAWASPDRGPAPSTSGVSSEMLASVSAEVGSLP
AGERVSRPEAAVPGYQHPSEAMNAHTPQFFIYKIDASNREQRLEDKGDNPLELGEDCSLA
LVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWY
CPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCIG
QKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQ
VVTRYAYVLFYRRRNSPVERPPRAGHSEHHPDLGPAAESAASQGLGPGQAPEVAPTRTAP
ERFAPPVDRPAPTYSNMEEVD
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaggggccagcaccacaggcccaaggagagggcccctgggactggaagaggcc
accagtaagaagaagcagaaggatcgagcaaaccaggagagcaaggatggagatcccagg
agaggtgggtcagcatccgctcctcaggaggagcataccaaagaggaagttcatggagac
cctcacaatctttttggaactccttctacagagttgttgctggattggaggcagagttct
gatgaggtgattgtcaagttgcgtgtgggagctggtcccctgaggctggatgaagtagat
gctgctttcacggacacagactgtgtggtgcggcttccaggtggtcggcagtggggtggt
gttttctatgctgagatagatggttcctgtaccaaagtgcaggctcgcaaaggtggcctc
ctgcagctctcactgcccaagaaggtgcctatgctcatgtggccctctctcctgaagaaa
cctctagggacccaggagttggtgccagggctgcggtgccaggagaatgggcaggaagca
tctcccattgcctcggagccaggccctgagccccgccgggctaagcaggaggcccggaac
cagaaacgggcccagggccgtagtgaggcaggcacaggggctggccctggggcccaggca
ggccccagcgccaagagagctgtgcatctccgcagagggccagaaggggaagggtccaga
gatggccctggaccccggggtgatgccccccctttcctggctgagccagcatccacccag
gctgaggctgaggaacagctccgtgtaccaccactgaacccccagacctgcctcctgggc
tcagaggaggatctagaacttttgacaggagagaaggcagtgtccgccaggaatgatcca
gtgtccccagccatggcccggagcagagaccccgagaaaggtgaccgttccaaagaggag
atggcagtggcagcagatgctgcaaccttggtggatgagcctgagtccatggtgaacctg
gcatttgtcaagaatgactcctatgagaaggggccggactcagtggtggtgcacgtgtac
gtgaaggaaatccgcagggacacctctcgagtgcttttccgcgagcaggacttcacgctt
atcttccagaccagggatggaaacttcctgagactgcacccgggctgcgggccccacacc
accttccgttggcaggtgaagctcaggaacctgatcgagccagagcaatgcaccttctgc
ttcacggcctctcgcattgacatctgcctccataagcggcagagtcagcgctgggggggc
ttggaggccccagctgcacgaggtgcagtgggtggtgcaaaggttgccgtgccgacaggt
ccaacccctctggattcaacccccccgggaagtgccccccaccccttgacaggccaggaa
gaggcccggggtgtggagaaggagaagcccaaggctcgatctgaggacacaggcttagat
ggtgtggcagcccgcacccccatggagcatgtaaccccaaagccagagccacacctagca
tcgcccaagcccacgtgtatggtgcctccaatgccccatagcccagtgagtggagatagt
gtggaggaagaggaggaggaagagaagaaggtgtgtctgccaggcttcactggccttgtc
aatctaggcaacacctgcttcatgaacagcgtcattcagtctctgtccaatactcgggaa
ctgcgggacttcttccatgaccgctcctttgaggccgagatcaactataacaacccgctg
gggactggtgggcgtctggccatcggttttgctgtgctgctccgggcactgtggaaggga
acccaccatgccttccagccctccaagttgaaggccattgtggcgagcaaagccagccag
ttcacaggctatgcacagcatgatgcccaggagttcatggctttcctgctggatgggctg
cacgaggacttgaaccgaattcagaataagccctacacagagactgtggactcagacggg
cgccctgatgaggtggtagctgaggaagcctggcagcggcacaagatgaggaatgattct
ttcatcgtggacctatttcagggccaatacaagtcgaagctggtgtgccctgtgtgtgcg
aaggtctccatcacttttgacccattcctgtacctgccggtgcccttgccgcagaagcag
aaggttctccctgtcttctattttgcgcgggagccccatagcaagcccatcaagtttctg
gtgagcatcagcaaggagaactccagtgcgagtgaagtgttggactccctctctcagagt
gtccacgtgaagcctgagaacctgcgtctggctgaggttattaagaatcgcttccaccgt
gtgttcttgccctcccactccctggacactgtgtccccttctgacacgctcctctgcttt
gagctgctgtccccagagttggctaaggagcgggtagtggtgcttgaagtgcaacagcgc
ccccaggtgcccagcatccctatctccaagtgtgcagcctgccagcggaagcagcagtca
gaggatgagaagctgaagcgctgtacccggtgctaccgtgtgggctactgcaaccagctc
tgtcagaaaacccactggcctgatcacaagggcctctgccgccctgagaacattggctac
cccttcctggtcagtgtacctgcctcacggctcacttatgcccgtcttgctcagctgcta
gagggctatgcccggtactctgtgagtgtgttccagccacccttccagcctggccgcatg
gccttggagtcccagggccctggctgcaccacaatgctgtccactagctccctggaggct
ggggacagtgagagggaccctgttcagcctcctgaacttcagttggtgacccctgtggct
gaaggggatacaggggtcccccgggcatgggcatcccctgatcggggccctgcacccagt
accagtggagtttcttctgagatgctggccagtgtgtctgctgaagttggctccttgcct
gctggtgagagggtgtcccggcctgaagctgccgtgcccggataccaacacccaagtgaa
gccatgaatgcccacacaccccagttctttatctataaaattgacgcatccaaccgagaa
cagcggctagaggacaaaggcgataaccccctagagctgggtgaggattgcagtctggct
ctagtctggcggaacaacgagcgcctgcaggagttcgtgttggtagcctccaaggagctg
gaatgtgctgaggacccaggctctgctggtgaggctgcccgtgctggccacttcactctg
gaccagtgcctgaacctcttcacgcggcctgaggtgctggcacctgaggaggcttggtac
tgcccacagtgcaaacaacaccgtgaggcctctaagcagctgttgctgtggcgcctgccg
aatgtgctcattgtccagctcaagcgcttctcctttcgcagcttcatctggcgtgacaag
atcaacgacttggtggagttccctgttcggaatctggacctgagcaagttctgcatcggt
cagaaagaggaacagctgcccagctacgacctgtatgctgtcatcaaccactatggaggc
atgattggtggtcactacactgcttgcgcgcgcctgcccaatgaccgcagcagccagcgc
agcgacgtgggctggcgcttgtttgatgacagcacggtgacaacggtagacgagagccag
gtcgtgacgcgttatgcctatgtactcttctaccgccggcggaactctcctgtggagagg
cccccccgggcaggtcactcagagcaccaccccgacctaggccctgcagctgagtctgct
gccagccagggactaggccctggccaggcccccgaggtggcccccacgcggacagcccct
gaacgcttcgccccccctgtggaccgcccagcccctacctacagcaacatggaggaggtc
gattag

DBGET integrated database retrieval system