KEGG   Sus scrofa (pig): 100188980Help
Entry
100188980         CDS       T01009                                 

Gene name
PGAM2
Definition
phosphoglycerate mutase 2 (muscle)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100188980 (PGAM2)
   01230 Biosynthesis of amino acids
    100188980 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100188980 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100188980 (PGAM2)
Enzymes [BR:ssc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100188980 (PGAM2)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100188980 (PGAM2)
  Exosomal proteins of melanoma cells
   100188980 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGAEEAKRGAHAIKDAKMEFDICYTSVL
KRAIRTLWTILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYSSISKERRYAGLKPGELPTCESLKDTIARALPFWNDEIAPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDQALKPTKPMRFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccgcctcgtgatggttcggcacggcgagagcacctggaaccaggagaac
cgcttctgcggctggtttgacgcggagctgagcgagaagggggccgaggaggccaagagg
ggggcccatgccatcaaggacgcaaagatggaatttgacatctgctacacgtcggtgctg
aagcgggccatacgcaccctctggaccatcctggacggcacggaccagatgtggctgccc
gtggtgcgcacctggcgcctcaacgagcggcactacggggggctcaccggcctcaacaag
gcggagacggccgccaagcacggggaggagcaggtgaagatctggaggcgctccttcgac
atcccaccgccccccatggatgagaagcacccctactacagctccatcagcaaggagcgg
cggtacgcaggcctgaagcccggggaactgcccacgtgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaacgatgagatcgcgccccagatcaaggcaggcaagaga
gtgctcatcgcagcccacgggaacagcctgcggggcatcgtcaagcatctggaagggatg
tccgaccaggccatcatggagctgaacctgcccacagggatccccatcgtgtacgagctg
gaccaggcgctgaagcccaccaagcccatgcgcttcctgggcgacgaggagacggtgcgc
aaggccatggaggccgtggccgcccagggcaaggccaagtga

DBGET integrated database retrieval system