KEGG   Sus scrofa (pig): 100188980Help
Entry
100188980         CDS       T01009                                 

Gene name
PGAM2
Definition
(RefSeq) phosphoglycerate mutase 2 (muscle)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100188980 (PGAM2)
   01230 Biosynthesis of amino acids
    100188980 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100188980 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100188980 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100188980 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100188980 (PGAM2)
Enzymes [BR:ssc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100188980 (PGAM2)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100188980 (PGAM2)
  Exosomal proteins of melanoma cells
   100188980 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGAEEAKRGAHAIKDAKMEFDICYTSVL
KRAIRTLWTILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYSSISKERRYAGLKPGELPTCESLKDTIARALPFWNDEIAPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDQALKPTKPMRFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccgcctcgtgatggttcggcacggcgagagcacctggaaccaggagaac
cgcttctgcggctggtttgacgcggagctgagcgagaagggggccgaggaggccaagagg
ggggcccatgccatcaaggacgcaaagatggaatttgacatctgctacacgtcggtgctg
aagcgggccatacgcaccctctggaccatcctggacggcacggaccagatgtggctgccc
gtggtgcgcacctggcgcctcaacgagcggcactacggggggctcaccggcctcaacaag
gcggagacggccgccaagcacggggaggagcaggtgaagatctggaggcgctccttcgac
atcccaccgccccccatggatgagaagcacccctactacagctccatcagcaaggagcgg
cggtacgcaggcctgaagcccggggaactgcccacgtgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaacgatgagatcgcgccccagatcaaggcaggcaagaga
gtgctcatcgcagcccacgggaacagcctgcggggcatcgtcaagcatctggaagggatg
tccgaccaggccatcatggagctgaacctgcccacagggatccccatcgtgtacgagctg
gaccaggcgctgaagcccaccaagcccatgcgcttcctgggcgacgaggagacggtgcgc
aaggccatggaggccgtggccgcccagggcaaggccaagtga

DBGET integrated database retrieval system