KEGG   Sus scrofa (pig): 100190899Help
Entry
100190899         CDS       T01009                                 

Gene name
USP7
Definition
ubiquitin specific peptidase 7 (herpes virus-associated) (EC:3.4.19.12)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ssc04068]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ssc05203]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:ssc05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ssc05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 1103 aa AA seqDB search
MNHQQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVAMSDGHNNTEEDM
EDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFL
QCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDL
EKGFIDDDXVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLR
KAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQEL
CRVLLDNVENKMKGTCVEGTILKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKN
IFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNI
KINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCK
FDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESRLSEVLQAVTDHDIPQQ
LVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKN
SSLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWT
IFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPV
MCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSE
LPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVARTVAQRLNTDPMLLQF
FKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWL
NSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELL
ECLSPATSRTFRIEEVPLDQVAIDKENEMLITVAHFHKEVFGTFGIPLLLRIHQGEHFRE
VMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGL
DHFNKAPKRSRYTYLEKAIKIHN
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccagcaacagcagcagcagcagcagaaagcgggcgagcagcagctcagcgag
cccgaggacatggagatggaagctggagatacagatgacccaccaagaattactcaaaac
cctgttatcaacgggaatgtagccatgagtgatggacacaacaacacagaggaagatatg
gaggatgacacgagttggcgctccgaggcgacctttcagttcactgtcgagcgcttcagc
agactgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgccatggaagatt
atggtgatgccacgcttttatccagacagaccacaccaaaaaagcgtaggattctttctc
cagtgcaatgctgaatctgattccacgtcgtggtcctgtcacgcgcaggccgtgctgaag
atcatcaactacagggatgacgagaagtccttcagccgccgcatcagccacttgttcttc
cataaagagaacgactggggcttctccaatttcatggcctggagtgaagtgactgatctt
gagaaaggatttatagatgatgacanagttactttcgaagtctttgtacaggcggatgcc
ccccatggagttgcgtgggattcaaagaagcacacgggctatgtcggtttaaagaatcag
ggagcgacttgttacatgaacagcttgctgcagactttatttttcacaaaccaactacga
aaggctgtgtacatgatgccaacagagggcgacgattcttccaaaagcgtccctttagca
ttacaaagagtcttctatgaattacagcacagcgataagcccgtaggaacaaagaagctg
accaagtcttttgggtgggaaactttagatagcttcatgcaacatgacgttcaggagctg
tgtcgagtgttgcttgataatgtggaaaataagatgaaaggcacgtgtgtagaaggcacc
atacttaaattattcagaggcaagatggtgtcgtatatccagtgtaaagaggtcgactac
cgatcagatagaagagaagattattacgacatccagctaagtataaaaggaaagaaaaat
atatttgaatcatttgtggattacgtggcagtagaacaactagatggcgacaataaatac
gatgccggggagcacggcttgcaggaagccgagaaaggtgtgaaattcctaacattgcca
ccagtgttacatctacagctgatgagatttatgtatgaccctcagacggaccaaaacatc
aagatcaatgataggtttgaattccctgaacagttaccacttgatgaatttttgcaaaaa
acagatcctaaagaccctgcaaattacatccttcatgcagtcctggtgcacagtggagat
aatcacggtggacattacgtggtctatctgaaccccaaaggggacggcaaatggtgcaag
tttgacgacgacgtggtgtcaaggtgcacgaaggaggaggccatcgagcacaactacggg
ggccacgacgacgacctctccgtgcggcactgcaccaacgcctacatgctggtgtacatc
cgggagtcccggctcagtgaggttttacaagctgtcaccgaccatgacatccctcagcag
ctggtggaacgcttgcaggaggagaaaaggatcgaggctcagaagcggaaggagcgtcaa
gaagcgcatctctacatgcaagtgcagatcgttgcagaggaccagttttgtggccatcaa
ggaaatgatatgtatgatgaggaaaaggtgaaatacactgtgttcaaagtgttgaaaaac
tcctcgctggccgagttcgtgcagaacctctctcagaccatgggctttccacaagatcag
attcggttgtggcccatgcaggccaggagcaatggcaccaagcgaccggccatgctagac
aacgaggccgacggcaacaaaacaatgattgaactgagtgataatgaaaacccttggaca
atattcctggaaacagttgatcctgagctggctgctagtggagcaacattacccaagttt
gataaagatcatgatgtgatgttatttttgaaaatgtacgatcccaaaacacggagctta
aattactgtggccatatctacaccccgatatcctgtaaaatacgtgatctgctcccagtt
atgtgtgacagagcaggatttatccaagatactagtcttatcctctatgaggaagttaaa
ccgaatttaacagagagaattcaggactacgacgtgtctcttgataaagcccttgatgag
ctgatggatggcgatattatagtgtttcagaaggatgaccccgaaaatgataacagtgaa
ttacccaccgcaaaggaatatttcagagacctctatcaccgtgtcgatgtgattttctgt
gataaaacaatccccaatgatcctggatttgtagttacattatcaaataggatgaattat
tttcaggtggcaaggacagttgctcagaggctcaacacagacccgatgctgctccagttt
ttcaagtctcaaggttacagggatggcccaggtaatcctcttagacataattatgaaggt
accttacgagaccttctgcagttcttcaagccgcgacagcctaagaaactttactatcag
cagcttaagatgaaaatcacagacttcgaaaacaggcggagttttaaatgtatatggtta
aacagccaatttagggaagaggaaataacactatatccagacaagcacggctgcgtccgg
gacctgctggaggaatgtaaaaaggccgtggagctcggcgagaaggcgtcagggaaactt
aggctgctagaaattgtaagctacaaaattattggtgtgcatcaagaagatgaactatta
gaatgtttgtctcctgcgacgagtcggacatttcgaatagaggaagtacctttggaccag
gtggccatagataaggagaatgagatgctgatcacggtggcgcatttccacaaggaggta
ttcgggacgttcgggatcccgctcttgctgaggatccaccagggcgagcatttcagagaa
gtgatgaagcggattcagagtctgctagacatccaggagaaggagtttgagaagtttaaa
tttgccattgtgatgatgggccggcaccagtacataaacgaagatgagtatgaagtaaac
ttgaaagactttgaacctcagcctggtaacatgtctcaccctcggccttggctggggctc
gaccacttcaacaaagccccaaagaggagtcgctacacgtaccttgaaaaggccattaaa
atccacaactga

DBGET integrated database retrieval system