KEGG   Sus scrofa (pig): 100192320Help
Entry
100192320         CDS       T01009                                 

Gene name
BCMO1
Definition
beta-carotene 15,15'-monooxygenase 1 (EC:1.14.99.36)
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
ssc  Sus scrofa (pig)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100192320 (BCMO1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     100192320 (BCMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 547 aa AA seqDB search
MDILFGRNKKEQLEPVRARVTGKIPSWLQGILLRNGPGMHTVGETKYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYNANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATTETNYIRRINPLTLETLEKVDYRKYVAVNVATSHPHYDATGN
VLNIGTSIVDKGKTKYVIFKIPATAPEDGKKGRGPLKHTEVFCSIASRSLLSPSYYHSFG
VTENYVVFLEQPFRMDILKMATAYIRGVSWASCLAFHGEDKTYIHVIDQRTRKPVLSKFY
TDPMVVFHHVNAYEEDGCLVFDVIAYEDSSLYQLFYLAHLNEDFEENSRLTSVPTLKRFA
VPLHVDKDADVGSNLIKLASTTARALKEKDDQIYCQPELLCKGLELPRINYAYNGKPYRY
VFAAEVQWSPIPTKVIKYDLLTKSSLSWGEAHCWPAEPLFVPTPGAQDEDDGIILSAIVS
TDPQKLPFLLVLDAKTFTELARASVDVDMHLDLHGLFIPGTAWDVEKQTPSQEEQGRAVD
HGVDPRT
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggatatactatttggcagaaataagaaggagcagctggagcctgtgagggccagagtg
acaggcaagattccctcgtggctgcagggaatcttactccgcaacgggcccgggatgcac
acggtgggcgagaccaagtacaaccactggttcgatggcctggccttgctccacagcttc
acaatcagagatggtgaagtctattataggagcaaatacctgagaagcgatacctacaat
gccaatatcgaagcgaacaggatcgtggtgtcagaatttggaacaatggcctatccggac
ccctgcaaaaacatattttccaaggcgttctcctacctgtcccacaccatccctgatttc
acagacaactgcttgatcaacatcatgaagtgtggagaagacttctatgcgaccacggag
accaattacattaggagaatcaacccgctgaccctggagaccctggagaaggttgattat
cgtaaatacgtggctgtaaatgtggcaacatcgcatcctcattatgatgccactggaaac
gttctcaacataggcacatccatcgtggacaaggggaagacgaaatacgtgatctttaag
atcccggccacggcaccagaggacgggaagaaggggcgagggcccctgaagcacacggag
gtgttctgctccatcgcctcccgctccctcctctccccgagctactaccacagcttcggc
gtcaccgagaactacgtcgttttcctcgagcagcccttccggatggatatcctcaagatg
gccaccgcctacattcggggcgtgagctgggcctcctgcctggccttccacggggaggac
aagacttacattcacgtcattgaccaaagaacaaggaagcccgtgctgagcaagttctac
acggaccccatggtggtgtttcatcacgtcaacgcctacgaagaggacggctgcctcgtg
tttgacgtcatcgcctacgaggacagcagcctttaccagctcttctacttggcccacttg
aatgaggacttcgaggagaactccaggctcacctctgtgcccaccctcaagaggttcgcg
gtgcccctccacgtggacaaggatgcagacgtgggttccaatttaatcaaactggcgtct
actacagccagagccctgaaggaaaaagatgaccaaatctactgccagccggagctgctc
tgcaaaggcttagagctgcctcggatcaattatgcttacaacgggaagccataccgctac
gtctttgctgccgaagtccagtggagccccatcccaaccaaggtcataaaatatgacctt
ctcaccaagtcgtccttgagttggggtgaggcgcactgctggcccgcggagcccctgttc
gtgcctacgccgggtgcccaggacgaggatgacggaattatcttatcagccatcgtctct
accgatccccagaagctgccgtttctgcttgttctggatgccaaaacttttacggaattg
gctcgtgcttccgttgacgtagacatgcacctggatctccacgggctgttcatcccgggc
acagcctgggatgtggagaagcagaccccttcccaggaggagcagggtagggcggtggac
cacggggtagacccgcggacctga

DBGET integrated database retrieval system