KEGG   Sus scrofa (pig): 100192448Help
Entry
100192448         CDS       T01009                                 

Gene name
SLC9A3R2
Definition
solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
ssc  Sus scrofa (pig)
Pathway
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100192448 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 337 aa AA seqDB search
MAAPEPLRPRLCLLVRGEHGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTRLLVVDKETDEELRRRQLTCTEEMAQRGLPPALDPWE
PKADWAPAGSLSGEAGQKDVNGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVD
PGSPAAHSGLRAQDRLIEVNGQNVEGLRHAEVVACIKAREDEARLLVVDPETDAYFKRLR
VTPTQEHMEGPLPSPVTNGTSSAQLNGGSVCSSRSDLPGLDKDTEDSSTWKRDPFQESGL
HLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccggagccgctgcggccgcgcctgtgcctcctggtgcgcggcgagcacggc
tacggcttccacctgcacggcgagaagggccgccgcgggcagttcattcggcgcgtggag
ccgggttccccggccgaggcggcggcgctgcgcgccggggaccgcctggtcgaggtcaac
ggcgtcaacgtggagggcgagacgcaccaccaggtggtgcagcggatcaaggctgtggag
ggccagacgcggctgctcgttgtggacaaggagacggacgaggagctccgcaggcgccag
ctgacttgcaccgaggagatggcccagcgagggctgccgcctgcccttgacccctgggag
ccgaaggcggactgggcgcccgcaggcagcctcagcggtgaggccggccagaaggatgtc
aacgggcccctgagggagctgcgcccaaggctctgccacctgcgaaaaggcccccagggt
tacgggtttaacctgcacagcgacaagtcccggcctggacagtacatccgctccgtggac
ccaggctcacctgctgcccactccggcctccgagcccaggaccgactcatagaggtgaac
gggcagaatgtggaggggctgcggcacgcggaggtggttgcctgcatcaaggcgcgggag
gacgaggcccggctgctggtggtggaccccgagacggatgcgtacttcaagcggctgcgg
gtcacacccacccaggagcacatggaaggtccactgccatcacctgtcaccaatgggacc
agctcagcccagctcaatggtggctccgtgtgctcgtcccgaagtgacctgcccggctta
gacaaggacactgaggacagcagcacctggaagcgtgaccctttccaggagagtggcctc
cacctgagccccacggcggctgaggccaaggagaaggcgagggccaccagggtcaacaag
cgggcgccacagatggactggaaccggaagcgtgagatcttcagcaacttctga

DBGET integrated database retrieval system