KEGG   Sus scrofa (pig): 100233191Help
Entry
100233191         CDS       T01009                                 

Gene name
MAP2K1
Definition
mitogen-activated protein kinase kinase 1 (EC:2.7.12.2)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
PI3K-Akt signaling pathway
Vascular smooth muscle contraction
Dorso-ventral axis formation
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Gap junction
Toll-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Prion diseases
Alcoholism
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100233191 (MAP2K1)
   04015 Rap1 signaling pathway
    100233191 (MAP2K1)
   04010 MAPK signaling pathway
    100233191 (MAP2K1)
   04012 ErbB signaling pathway
    100233191 (MAP2K1)
   04370 VEGF signaling pathway
    100233191 (MAP2K1)
   04668 TNF signaling pathway
    100233191 (MAP2K1)
   04066 HIF-1 signaling pathway
    100233191 (MAP2K1)
   04068 FoxO signaling pathway
    100233191 (MAP2K1)
   04024 cAMP signaling pathway
    100233191 (MAP2K1)
   04022 cGMP - PKG signaling pathway
    100233191 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100233191 (MAP2K1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100233191 (MAP2K1)
  Cell growth and death
   04114 Oocyte meiosis
    100233191 (MAP2K1)
  Cellular commiunity
   04510 Focal adhesion
    100233191 (MAP2K1)
   04540 Gap junction
    100233191 (MAP2K1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100233191 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100233191 (MAP2K1)
   04660 T cell receptor signaling pathway
    100233191 (MAP2K1)
   04662 B cell receptor signaling pathway
    100233191 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100233191 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100233191 (MAP2K1)
   04062 Chemokine signaling pathway
    100233191 (MAP2K1)
  Endocrine system
   04910 Insulin signaling pathway
    100233191 (MAP2K1)
   04912 GnRH signaling pathway
    100233191 (MAP2K1)
   04915 Estrogen signaling pathway
    100233191 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100233191 (MAP2K1)
   04917 Prolactin signaling pathway
    100233191 (MAP2K1)
   04921 Oxytocin signaling pathway
    100233191 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100233191 (MAP2K1)
   04916 Melanogenesis
    100233191 (MAP2K1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100233191 (MAP2K1)
  Nervous system
   04725 Cholinergic synapse
    100233191 (MAP2K1)
   04726 Serotonergic synapse
    100233191 (MAP2K1)
   04720 Long-term potentiation
    100233191 (MAP2K1)
   04730 Long-term depression
    100233191 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100233191 (MAP2K1)
  Development
   04320 Dorso-ventral axis formation
    100233191 (MAP2K1)
   04380 Osteoclast differentiation
    100233191 (MAP2K1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100233191 (MAP2K1)
   05206 MicroRNAs in cancer
    100233191 (MAP2K1)
   05205 Proteoglycans in cancer
    100233191 (MAP2K1)
   05210 Colorectal cancer
    100233191 (MAP2K1)
   05212 Pancreatic cancer
    100233191 (MAP2K1)
   05214 Glioma
    100233191 (MAP2K1)
   05216 Thyroid cancer
    100233191 (MAP2K1)
   05221 Acute myeloid leukemia
    100233191 (MAP2K1)
   05220 Chronic myeloid leukemia
    100233191 (MAP2K1)
   05218 Melanoma
    100233191 (MAP2K1)
   05211 Renal cell carcinoma
    100233191 (MAP2K1)
   05219 Bladder cancer
    100233191 (MAP2K1)
   05215 Prostate cancer
    100233191 (MAP2K1)
   05213 Endometrial cancer
    100233191 (MAP2K1)
   05223 Non-small cell lung cancer
    100233191 (MAP2K1)
  Neurodegenerative diseases
   05020 Prion diseases
    100233191 (MAP2K1)
  Substance dependence
   05034 Alcoholism
    100233191 (MAP2K1)
  Infectious diseases
   05164 Influenza A
    100233191 (MAP2K1)
   05161 Hepatitis B
    100233191 (MAP2K1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100233191 (MAP2K1)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100233191 (MAP2K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 393 aa AA seqDB search
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYL
REKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggccttgcagaagaagctggaggagctg
gagctcgatgaacagcagcggaagcgcctcgaggcctttcttacccagaagcagaaggtg
ggggaactgaaggatgacgacttcgagaagatcagtgagctgggtgccggcaatggaggt
gtggtgttcaaggtctcccacaagccgtccggcctggtcatggcccgaaagctaattcac
ctggagatcaaacctgcaatccggaatcagattataagggagctgcaggttctacatgag
tgcaattccccctacattgtgggcttctacggcgcattctacagcgatggcgagatcagt
atctgcatggagcacatggatggcggctccctggaccaggtgttgaaagaagccaagaga
attcctgaggaaatcctggggaaggtcagcatcgcggttctgcggggcctggcatatctc
cgggaaaagcaccagatcatgcaccgagatgtgaagccatccaacatccttgtcaactcc
cgaggggagatcaagttgtgcgactttggggtgagcgggcagctcatcgattccatggcc
aactccttcgtgggaacacggtcctacatgtctccggagcggctgcagggcactcactac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggtcgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttggatgccaggtggag
ggagatgcagctgagacaccacccaggccaaggaccccggggaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgctggattacatagtcaatgag
cctcctcccaaactacccagtggagtattcagcctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccctgcagagagagccgatttgaagcaactcatggttcatgctttc
atcaaaagatctgatgctgaggaagtagattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacacccacccatgcggctggtgtctaa

DBGET integrated database retrieval system