KEGG   Sus scrofa (pig): 100233191Help
Entry
100233191         CDS       T01009                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04114  Oocyte meiosis
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04218  Cellular senescence
ssc04270  Vascular smooth muscle contraction
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04620  Toll-like receptor signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04668  TNF signaling pathway
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04730  Long-term depression
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04934  Cushing's syndrome
ssc05020  Prion diseases
ssc05034  Alcoholism
ssc05161  Hepatitis B
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
Module
ssc_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100233191 (MAP2K1)
   04015 Rap1 signaling pathway
    100233191 (MAP2K1)
   04010 MAPK signaling pathway
    100233191 (MAP2K1)
   04012 ErbB signaling pathway
    100233191 (MAP2K1)
   04370 VEGF signaling pathway
    100233191 (MAP2K1)
   04371 Apelin signaling pathway
    100233191 (MAP2K1)
   04668 TNF signaling pathway
    100233191 (MAP2K1)
   04066 HIF-1 signaling pathway
    100233191 (MAP2K1)
   04068 FoxO signaling pathway
    100233191 (MAP2K1)
   04072 Phospholipase D signaling pathway
    100233191 (MAP2K1)
   04071 Sphingolipid signaling pathway
    100233191 (MAP2K1)
   04024 cAMP signaling pathway
    100233191 (MAP2K1)
   04022 cGMP - PKG signaling pathway
    100233191 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100233191 (MAP2K1)
   04150 mTOR signaling pathway
    100233191 (MAP2K1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100233191 (MAP2K1)
  Cell growth and death
   04114 Oocyte meiosis
    100233191 (MAP2K1)
   04210 Apoptosis
    100233191 (MAP2K1)
   04218 Cellular senescence
    100233191 (MAP2K1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100233191 (MAP2K1)
   04540 Gap junction
    100233191 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100233191 (MAP2K1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100233191 (MAP2K1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100233191 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100233191 (MAP2K1)
   04660 T cell receptor signaling pathway
    100233191 (MAP2K1)
   04662 B cell receptor signaling pathway
    100233191 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100233191 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100233191 (MAP2K1)
   04062 Chemokine signaling pathway
    100233191 (MAP2K1)
  Endocrine system
   04910 Insulin signaling pathway
    100233191 (MAP2K1)
   04912 GnRH signaling pathway
    100233191 (MAP2K1)
   04915 Estrogen signaling pathway
    100233191 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100233191 (MAP2K1)
   04917 Prolactin signaling pathway
    100233191 (MAP2K1)
   04921 Oxytocin signaling pathway
    100233191 (MAP2K1)
   04926 Relaxin signaling pathway
    100233191 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100233191 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    100233191 (MAP2K1)
   04916 Melanogenesis
    100233191 (MAP2K1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100233191 (MAP2K1)
  Nervous system
   04725 Cholinergic synapse
    100233191 (MAP2K1)
   04726 Serotonergic synapse
    100233191 (MAP2K1)
   04720 Long-term potentiation
    100233191 (MAP2K1)
   04730 Long-term depression
    100233191 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100233191 (MAP2K1)
  Development
   04380 Osteoclast differentiation
    100233191 (MAP2K1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100233191 (MAP2K1)
   05230 Central carbon metabolism in cancer
    100233191 (MAP2K1)
   05231 Choline metabolism in cancer
    100233191 (MAP2K1)
   05206 MicroRNAs in cancer
    100233191 (MAP2K1)
   05205 Proteoglycans in cancer
    100233191 (MAP2K1)
   05210 Colorectal cancer
    100233191 (MAP2K1)
   05212 Pancreatic cancer
    100233191 (MAP2K1)
   05225 Hepatocellular carcinoma
    100233191 (MAP2K1)
   05226 Gastric cancer
    100233191 (MAP2K1)
   05214 Glioma
    100233191 (MAP2K1)
   05216 Thyroid cancer
    100233191 (MAP2K1)
   05221 Acute myeloid leukemia
    100233191 (MAP2K1)
   05220 Chronic myeloid leukemia
    100233191 (MAP2K1)
   05218 Melanoma
    100233191 (MAP2K1)
   05211 Renal cell carcinoma
    100233191 (MAP2K1)
   05219 Bladder cancer
    100233191 (MAP2K1)
   05215 Prostate cancer
    100233191 (MAP2K1)
   05213 Endometrial cancer
    100233191 (MAP2K1)
   05224 Breast cancer
    100233191 (MAP2K1)
   05223 Non-small cell lung cancer
    100233191 (MAP2K1)
  Neurodegenerative diseases
   05020 Prion diseases
    100233191 (MAP2K1)
  Substance dependence
   05034 Alcoholism
    100233191 (MAP2K1)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100233191 (MAP2K1)
  Infectious diseases
   05164 Influenza A
    100233191 (MAP2K1)
   05161 Hepatitis B
    100233191 (MAP2K1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100233191 (MAP2K1)
   05165 Human papillomavirus infection
    100233191 (MAP2K1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100233191 (MAP2K1)
   01522 Endocrine resistance
    100233191 (MAP2K1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100233191 (MAP2K1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE7 family
   100233191 (MAP2K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH Seadorna_VP7 DUF3216 Kdo NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100233191
NCBI-ProteinID: NP_001137188
UniProt: B8XSJ8
Position
1
AA seq 393 aa AA seqDB search
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYL
REKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggccttgcagaagaagctggaggagctg
gagctcgatgaacagcagcggaagcgcctcgaggcctttcttacccagaagcagaaggtg
ggggaactgaaggatgacgacttcgagaagatcagtgagctgggtgccggcaatggaggt
gtggtgttcaaggtctcccacaagccgtccggcctggtcatggcccgaaagctaattcac
ctggagatcaaacctgcaatccggaatcagattataagggagctgcaggttctacatgag
tgcaattccccctacattgtgggcttctacggcgcattctacagcgatggcgagatcagt
atctgcatggagcacatggatggcggctccctggaccaggtgttgaaagaagccaagaga
attcctgaggaaatcctggggaaggtcagcatcgcggttctgcggggcctggcatatctc
cgggaaaagcaccagatcatgcaccgagatgtgaagccatccaacatccttgtcaactcc
cgaggggagatcaagttgtgcgactttggggtgagcgggcagctcatcgattccatggcc
aactccttcgtgggaacacggtcctacatgtctccggagcggctgcagggcactcactac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggtcgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttggatgccaggtggag
ggagatgcagctgagacaccacccaggccaaggaccccggggaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgctggattacatagtcaatgag
cctcctcccaaactacccagtggagtattcagcctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccctgcagagagagccgatttgaagcaactcatggttcatgctttc
atcaaaagatctgatgctgaggaagtagattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacacccacccatgcggctggtgtctaa

DBGET integrated database retrieval system