KEGG   Sus scrofa (pig): 100271876Help
Entry
100271876         CDS       T01009                                 

Gene name
KCNMB1
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 1
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
ssc  Sus scrofa (pig)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:ssc04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:ssc04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 191 aa AA seqDB search
MGKKLVMAQKRGETRALCLGVAMVVCAVIAYYILGTTVLPLYQKSVWTQESTCHLIETNI
RDQEELEGKRVPQYPCLWVNVSSVGRWAVLYHTEDTRDQNQQCSYIPGSLDNYQTARADV
EKVRAKFHEHQVFYCFSTTRENETSVLYQRLYGPQTLLFSLFWPTFLLTGGLLIIVMVKV
NQSLSILAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagctggtgatggcccagaaacggggagagacccgagccctctgcctgggt
gttgccatggtggtgtgtgctgtcatcgcctactacatcctgggcacgaccgtgctgccc
ctctaccagaaaagcgtgtggacccaggaatccacctgtcacctgattgagaccaacatc
agggaccaggaggagctggaaggcaagagggtgccccagtacccgtgcctgtgggtcaac
gtgtcatccgtgggccggtgggccgtgctgtaccacacagaggacactcgggaccagaac
cagcagtgctcctacatcccaggcagcctggacaactaccagacggcccgggccgacgtg
gagaaagttagagccaagttccacgagcaccaggttttctactgcttctccaccactcgg
gagaacgagaccagcgtcttgtatcagcgcctctacgggccccagaccctcctcttctcc
ctcttctggcccaccttcctgctgaccggcggcctcctcattatcgtcatggtgaaggtc
aaccagtccctctccatcctggcggcccagaagtag

DBGET integrated database retrieval system