KEGG   Sus scrofa (pig): 100271878Help
Entry
100271878         CDS       T01009                                 

Gene name
KCNMB3
Definition
(RefSeq) calcium-activated potassium channel subunit beta-3 isoform X1
  KO
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
ssc  Sus scrofa (pig)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100271878 (KCNMB3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100271878 (KCNMB3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100271878 (KCNMB3)
Ion channels [BR:ssc04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100271878 (KCNMB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
13
AA seq 293 aa AA seqDB search
MTQVKGVHFAQPPGLMEPFSIPVQITLQGGRRRQGRTAFSTSGGKRNIDHSDGDPPDMHK
KLPSSAGEDRAMLLGFAMMGFSVLMFFLLGITMLKPFMLSTQREESNCTIIHTHIMDDWM
DCAFTCGVDCQGQGKYPCLQVFVNLTHSGQKALLHYNEEAVQINSKCFYTPKCRRDGNDL
LNSALNIKEFFDHKNRTPFSCFYSPDNQSEDVILIKKYDQMVIFHCLFWPSMTMLGGALI
VGMVRLTQYLFLLCEKYSTALRDEVSGKVPYVARNQFKLWSVGRSKGRSQEIL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggtgaaaggagtccattttgcccagccccctggtctcatggagccgttcagc
atccccgttcaaattacactccagggcggccggagacgccaggggaggacagccttttct
acctcaggtgggaagagaaacatagatcacagtgatggagacccaccagatatgcataag
aagctgccatccagtgctggagaggaccgagccatgctgttagggtttgcaatgatgggc
ttctctgtcctaatgttcttcttgcttggaatcaccatgctaaagccctttatgctcagc
actcagagagaagaatcaaactgcaccatcatccacacacacatcatggacgactggatg
gactgtgctttcacctgtggggtggactgccaaggtcagggcaagtacccatgcctgcag
gtgtttgtgaacctcacccattcaggtcagaaagctctcctacattataatgaagaggct
gtccagataaattccaagtgcttttacacacccaagtgccgccgggatggaaatgatttg
cttaacagtgctctgaacataaaggaattctttgatcacaaaaacagaacccccttttct
tgcttctatagtccagataaccaatccgaagatgttattctcataaaaaagtatgaccag
atggttatcttccactgtctgttttggccttccatgactatgctaggtggtgctctgatt
gttggcatggtgagattaacacagtacctgtttctattgtgtgaaaaatacagcactgca
ctcagagatgaggtaagtggcaaagtaccttacgtggcacggaatcaattcaaactgtgg
agtgtggggaggagcaaagggaggagtcaagaaatcttatga

DBGET integrated database retrieval system