KEGG   Sus scrofa (pig): 100271878Help
Entry
100271878         CDS       T01009                                 

Gene name
KCNMB3
Definition
potassium large conductance calcium-activated channel, subfamily M beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
ssc  Sus scrofa (pig)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:ssc04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:ssc04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 229 aa AA seqDB search
MTQVKGVHFAQPPGLMEPFSIPVQITLQGGRRRQGSTQREESNCTIIHTHIMDDWMDCAF
TCGVDCQGQGKYPCLQVFVNLTHSGQKALLHYNEEAVQINSKCFYTPKCRRDGNDLLTSA
LTXKEFFDHKNRTPFSCFYSPDNHSEDVILIKKYDQMVIFHCLFWPPMTMLGGALIVGMV
RLTQYLFLLCEKYSTALRDEVSGKVPYVARNQFKLWSVGRSKGRSQEIL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggtgaaaggagtccattttgcccagccccctggtctcatggagccgttcagc
atccccgttcaaattacactccagggcggccggagacgccaggggagcactcagagagaa
gaatcaaactgcaccatcatccacacacacatcatggacgactggatggactgtgctttc
acctgtggggtggactgccaaggtcagggcaagtacccatgcctgcaggtgtttgtgaac
ctcacccattcaggtcagaaagctctcctacattataatgaagaggctgtccagataaat
tccaagtgcttttacacacccaagtgccgccgggatggaaatgatttgcttaccagtgct
ctgaccnataaagaattctttgatcacaaaaacagaacccccttttcttgcttctatagt
ccagataaccattccgaagatgttattctcataaaaaagtatgaccagatggttatcttc
cactgtctgttttggcctcccatgactatgctaggtggtgctctgattgttggcatggtg
agattaacacagtacctgtttctattgtgtgaaaaatacagcactgcactcagagatgag
gtaagtggcaaagtaccttacgtggcacggaatcaattcaaactgtggagtgtggggagg
agcaaagggaggagtcaagaaatcttatga

DBGET integrated database retrieval system