KEGG   Sus scrofa (pig): 100286778Help
Entry
100286778         CDS       T01009                                 

Gene name
PDK4
Definition
(RefSeq) pyruvate dehydrogenase kinase, isozyme 4
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100286778 (PDK4)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   100286778 (PDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3 Adaptin_N Fanconi_A_N
Motif
Other DBs
NCBI-GeneID: 100286778
NCBI-ProteinID: NP_001152778
Ensembl: ENSSSCG00000015334
Vega: OTTSUSG00000001679
UniProt: C1IHT9
Position
9
AA seq 407 aa AA seqDB search
MKAARFVMRSAGSLVPREVEHFSRYSPSPLSIKQLLDFGSENACERTSFAFLRQELPVRL
ANILKEIYILPDRLVNTSSVQLVKSWYIQSLMELVEFHEKSPEDQKVLADFVDTLIKVRN
RHHNVVPTMAQGILEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDLQT
ANPSHIGSIDPNCDVAAVVQDAFECSKMLCNQYYLTSPELKLTQVNGKLPGQPIHIVYVP
SHLHHMLFELFKNAMRATVEHQENWPSLTPIEVIVVLGKEDLTIKISDRGGGVPLRIIDR
LFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLPGYGTDAIIYLK
ALSSESIEKLPVFNKSAFKHYQMSSEAGDWCIPSKEPKNLAKEKVAV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggctcgctttgtgatgcgcagcgctggctccctggttccccgagaggtcgag
catttctcgcgctacagcccatccccgctgtccataaagcagctgctggacttcggttca
gaaaatgcatgtgaaagaacctcttttgcatttttgcgacaagagttgcctgtgaggcta
gccaatatcctgaaggaaatttatatcctccctgatcgattagtaaatacctcttcagtg
caattagttaagagctggtatatccagagcctgatggagttggtagaattccatgagaaa
agcccagaggatcagaaagtattagcagattttgtagacactctcatcaaagttcgaaat
agacaccataatgtagttcctacaatggcacaaggaatcctggagtataaagatgcctgt
acagttgaccctgtcaccaaccaaaatcttcagtatttcttggatcgattttacatgaac
cgtatttctacccggatgctgatgaaccaacacatcctgatatttagtgacttacagaca
gcaaatccaagccacattggcagcattgacccaaactgtgatgtggcagcagtggtccaa
gatgcctttgagtgttccaagatgctctgtaatcagtattatttaacatctccagaatta
aagctcacacaagtgaatggaaaacttccaggtcaaccaattcatattgtgtatgttcca
tctcaccttcatcatatgctctttgaactattcaagaatgcaatgagggctacagtcgaa
caccaggaaaactggccttctctgacaccaattgaggtgattgttgtcttgggaaaagaa
gatcttacaattaagatttcagacagaggaggtggtgttcccctgaggatcattgaccgt
cttttcagttacacgtattctacagcaccaacacctgtgatggataattcccggaatgct
cctttggctggttttggttacggcttgccaatttctcgtctctatgccaagtacttccaa
ggagatctaaacctctactctttgccaggatatggaacggatgctatcatctacctaaag
gctttgtcttctgaatctatagaaaaactcccagtctttaacaaatcagccttcaaacat
taccagatgagcagtgaggctggtgactggtgtatcccaagcaaagaaccaaagaacttg
gcgaaggaaaaagtggctgtgtga

DBGET integrated database retrieval system