KEGG   Sus scrofa (pig): 100286871Help
Entry
100286871         CDS       T01009                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1 (EC:2.7.11.2)
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
ssc  Sus scrofa (pig)
Pathway
HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100286871 (PDK1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100286871 (PDK1)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100286871 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 438 aa AA seqDB search
MRLARLLRGAASAGPGPGLRAACPSASRSLTSDSGSGPAPELGVPGQVDFYARFSPSPLS
MKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSL
QELLDFKDKSAEDAKTIYDFTDTVIRIRNRHNDVIPTMAQGVVEYKESFGVDPVTSQNVQ
YFLDRFYMSRISIRMLLNQHSLLFGGKGKGSLSHQKHIGSINPNCNVVEVIKDGYENARR
LCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVY
PPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYG
LPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEAD
DWCVPSREPKDMTTFRSA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgcggctgctgcgcggagccgcctcggccggcccgggccccgggctgcgc
gccgcctgccccagcgccagccgcagcctcacctcggactcgggctccggcccggcgcct
gaactcggcgttccgggccaagtggacttctacgcgcgcttctcgccgtccccgctctcc
atgaagcagttcctggacttcggatctgtgaatgcttgtgaaaagacctcatttatgttt
ctgcggcaagagttgcccgttaggttggcaaatataatgaaagaaataagtcttcttcca
gataatcttctcaggacaccatcagttcagttggtacaaagctggtatatccagagtctt
caggagcttcttgattttaaggacaaaagtgctgaagatgctaaaactatctatgacttt
acagatactgtgatacggatcaggaaccgacacaacgatgtgattcccacaatggctcaa
ggtgtggttgaatacaaggagagcttcggggtggatcctgtcaccagccaaaatgttcag
tactttttggatcgtttctacatgagtcgcatttcaattagaatgttactgaatcagcac
tctttattatttggtggaaaaggcaaaggaagcctatctcatcaaaaacacatcggaagc
ataaatccaaactgcaatgtagttgaagttattaaagatggctatgagaatgctaggcgt
ctatgtgacttgtattatattaactctcctgaactagaacttgaagaactaaatgcaaaa
tcaccaggacagccaatacaagtggtttatgtaccatcccatctctatcacatggtgttt
gaacttttcaagaatgcaatgagagcaacgatggagcaccacgctgacaaaggggtttac
ccgcctattcaagtccacgtcacactgggtaatgaggatttgactgtgaagatgagtgac
cgaggagggggtgttcctctgaggaagattgacagactcttcaactacatgtactccact
gcaccccggcctcgtgtcgagacgtcgcgagcagtgcctctggctggttttggttatgga
ttgcccatatcacgcctttatgcacagtacttccaaggagatctaaagttatactcccta
gaaggttatgggacagatgcagttatctacattaaggctctgtccacagactcaatagaa
agactcccagtgtataacaaagctgcctggaagcattacaacaccaaccatgaggctgat
gactggtgtgtccccagcagagaaccaaaagacatgacaacattccgcagtgcctag

DBGET integrated database retrieval system