KEGG   Sus scrofa (pig): 100302026Help
Entry
100302026         CDS       T01009                                 

Gene name
ST6GAL1, SIAT1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
ssc  Sus scrofa (pig)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100302026 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    100302026 (ST6GAL1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100302026 (ST6GAL1)
Glycosyltransferases [BR:ssc01003]
 Terminal extension
  Sialyltransferase
   100302026 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 518 aa AA seqDB search
MSQKQACFSAQDRVVSLNTSFIMIHTSLKKKFSCCLLVFLLFAIICVWKEKKKGSYYESL
KLQTKELQVLRSLEKLTPGSGSQSASSSGTQNAQRGSQALGSPSSPAKAXPEASFQVWNK
DSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGVKYSAEALLCHLRDNVNVSMVEATDF
PFNTSEWEGYLPKENIRTKAGPWGRCAVVSSAGSLKSSQLGREIGGFWGVTTCEMNQAKE
SKAQEASLFCQALEGAGAGEVICLLFYFLRVTARKNGLKPSTGSQKKKSSPKLDPLEQKE
VLMDYDEMSFQVHTVLAGILAAFSLKLSATIKTYTLYGASDVFLQLVTTEQRFLKDSLYG
EGILIVWDPSIYHSDIPKWYKNPDYRFFDNFKSYRKLHPDQPFYILKPQMPWELWDIIQE
ISPEAIQPNPPSSGMLGIIIMMTLCDQVDVYEFLPSKRKTDVCYYYQKFFDSACTMGAYH
PLLFEKNMVKHLNRGPDEDIYLLGKATLPGFRSIHCGA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaagcaggcctgcttttctgctcaggacagagtggtttccttgaacacatct
ttcattatgattcacaccagcttgaagaaaaaattcagctgctgcctgctggtctttctc
ctgtttgcgatcatttgtgtgtggaaggaaaagaagaaagggagttactatgaatccctt
aaattgcaaaccaaggagctccaggtgctgaggagtctggagaaactgactccagggtct
ggctcccagtctgcatcctccagcggcacccagaacgcccaaagaggcagccaggccctc
ggcagtcccagtagtccagccaaggcnnnnccagaggccagcttccaggtgtggaacaag
gacagctcttccaaaaaccttatccctaggctgcaaaagatctggaagaattacctgagc
atgaacaagtataaagtgtcctacaaggggccagggcccggtgttaagtacagtgctgag
gccctgctttgccacctccgggacaacgtgaacgtttccatggtagaagccacagatttt
cccttcaatacctctgaatgggagggttacctgccaaaggagaacatcaggaccaaggcc
gggccgtggggcaggtgtgctgtcgtctcatcagcgggatctctcaagtcctcccaactg
ggtcgagaaataggtgggttctggggtgttacgacgtgtgaaatgaatcaggctaaagaa
agcaaagcacaggaagcctcgctcttctgtcaggctctggaaggtgctggagcaggtgag
gtcatatgtctccttttttatttccttcgtgtgactgccaggaaaaatggtctgaaacca
agcacaggctctcaaaagaagaaaagtagtcccaaattggatcctctagagcagaaagaa
gtgctgatggattatgacgaaatgtcctttcaggtccacacagttctggctggcatcctt
gccgccttctcactgaagttaagtgctacaatcaaaacttacacactttacggggcttca
gatgtcttcctgcagttggtcaccacagaacagcgcttcctcaaagacagtctgtacggt
gaaggaatcctaattgtgtgggacccgtctatttaccattcagacatcccaaagtggtac
aagaatcccgactatcgtttcttcgataacttcaagagctatcgtaagctgcatcctgat
cagcccttttacatcctgaagccccagatgccttgggagctgtgggacatcattcaagaa
atctccccagaggccatccagcccaaccccccatcctctgggatgcttggcatcatcatc
atgatgacgctgtgtgaccaggtggatgtttatgagttcctcccatccaagcgcaagact
gacgtgtgctactactaccagaagttctttgacagcgcctgcaccatgggtgcctaccac
ccgctactctttgagaagaacatggtgaagcacctcaacaggggcccagacgaggacatc
tacctgcttgggaaagccacgctgccaggcttccggagcattcactgtggagcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system