KEGG   Sus scrofa (pig): 100302694Help
Entry
100302694         CDS       T01009                                 

Gene name
CES5A, CES7
Definition
carboxylesterase 5A
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 464 aa AA seqDB search
MSTEWVHPGQTLIWAVWVLAATTEGEKPTMDAPVRNTRLGWVRGKQATVLGNDKPVNIFL
GIPYAAPPVGPLRFAKPKPALPWNDFLNATSYPKLCLQNSEWLFLDQHILKVHYPKFGMS
EDCLYLNIHAPAHADTGSKLPITQDTNTQTIKQDMNNALRMKGSGTIETEEGAAKNQGGF
LREVAFELHLDDETGFGKEGTGDKHALGNWAFMDQVAALTWVQENIKFFGGDPHYVTIFG
ESAGAISVSSLILSPMAKGLFHRAIMESGVAIIPYLKAPDYERNEDLQMIAKICGCSVSD
SVALLQCLRAKSSKELLSINQETKAFTRVVDGFFFPHEPIELLTQKSFKPVPSIIGVNNH
ECGFLLPMKEFPEVLRGSNKSLVLQLMHSILVFTEPSSAIPHPQFQHPNSSENHVGRDSD
FQRNPTHTQGDSISCLKPVFTPPLSSQGPVFPEISGKVLALHLL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagagtgggtgcacccaggccagaccctgatctgggctgtttgggtccttgca
gccaccactgagggtgagaaacccaccatggatgcaccagtgaggaacaccaggctggga
tgggtccgggggaagcaagctactgtgctgggaaacgacaagcctgtgaacatattcctt
gggatcccttatgctgcaccccctgtgggacccctacgatttgcaaagccaaagcctgca
ttgccctggaatgatttcctcaatgccacatcctaccctaaattgtgcctccagaactcg
gagtggctgttcttagatcaacacattctcaaggtgcattaccccaaatttggaatgtcg
gaagactgcctgtaccttaacatccatgcaccggcccacgcagacactggctccaagctc
cctataactcaggacacaaatacccagactattaagcaggacatgaataatgctctgagg
atgaaaggcagtggaaccatagagacagaggagggagctgccaaaaatcagggaggcttc
ctaagggaggtggcatttgaattgcaccttgatgatgagactggatttgggaaggagggc
acaggagacaagcacgccctggggaactgggccttcatggaccaggtggctgccctgacc
tgggtccaggagaacatcaagttctttggtggggatccacactacgtgaccatcttcggc
gagtcagctggagccataagtgtttccagtcttattctgagccccatggccaaaggctta
ttccacagagccatcatggagagtggagtggccatcatcccttacctgaaggcccctgat
tacgagaggaatgaggatttgcagatgattgccaaaatctgtggctgcagtgtgtcagac
tccgtggccttgctgcaatgcctacgagcaaaatcatccaaggaattgctgagcatcaat
caggaaactaaggctttcactcgagtggttgatggctttttctttcctcatgagcctata
gaactattgactcaaaaatcatttaagccagttccttctatcatcggcgtcaataaccat
gagtgtggcttcctgctgcctatgaaagagtttcctgaggtcctcaggggctccaacaaa
tccttagtcctgcagttgatgcactcaattctggtctttacagagccgagctccgcaatc
cctcatccacaatttcaacatccaaatagctctgaaaaccatgtgggaagagattccgat
tttcaaagaaatcctactcacacgcagggtgattccatctcctgcctgaagccagtgttc
acacccccgctctcctcccaagggcctgtcttccctgagatttcagggaaagtgttggcc
ttgcaccttctttga

DBGET integrated database retrieval system