KEGG   Sus scrofa (pig): 100302694Help
Entry
100302694         CDS       T01009                                 

Gene name
CES5A
Definition
(RefSeq) LOW QUALITY PROTEIN: carboxylesterase 5A
  KO
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100302694 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
6
AA seq 585 aa AA seqDB search
MSREFRRSSQMSTEWVHPGQTLIWAVWVLAATTEESAMDAPVRNTRLGWVRGKQATVLGN
DKPVNIFLGIPYAAPPVGPLRFAKPKPALPWNDFLNATSYPKLCLQNSEWLFLDQHILKV
HYPKFGMSEDCLYLNIHAPAHADTGSKLPVMVWLPWGGFETGSASIFDGSALAAYEDVLV
VTIQYRLGMFGFFKXWDKHALGNWAFMDQVAALTWVQENIKFFGGDPHYVTIFGESAGAI
SVSSLILSPMAKGLFHRAIMESGVAIIPYLKAPDYERNEDLQMIAKICGCSVSDSVALLQ
CLRAKSSKELLSINQETKAFTRVVDGFFFPHEPIELLTQKSFKPVPSIIGVNNHECGFLL
PMKEFPEVLRGSNKSLVLQLMHSILHVPVQYLYLVANEYFHNKHSLIDIRNRFLDLLGDV
FFVVPGLVTAQYHRDAGAPVYFYEFQHRPQCLKDRKPAFVKADHTDEIRFVFGGAFLKGD
IVMFEGATEEEKWLSRKMMRYWANFARSGDPNGEGLPLWPAYGQTEEYLQLNLNLSVGQR
LKELELEFWTDTIPLVMSSSRVLLAPLSSFIFLSLFLPFFFSLVP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggagttcaggaggtccagccagatgagtacagagtgggtgcacccaggccag
accctgatctgggctgtttgggtccttgcagccaccactgaggagtcagccatggatgca
ccagtgaggaacaccaggctgggatgggtccgggggaagcaagctactgtgctgggaaac
gacaagcctgtgaacatattccttgggatcccttatgctgcaccccctgtgggaccccta
cgatttgcaaagccaaagcctgcattgccctggaatgatttcctcaatgctacatcctac
cctaaattgtgcctccagaactcggagtggctgttcttagatcaacacattctcaaggtg
cattaccccaaatttggaatgtcggaagactgcctgtaccttaacatccatgcaccggcc
cacgcagacactggctccaagctccctgtcatggtgtggctcccttggggtggctttgag
actggctcagcatccatctttgatgggtctgccctggctgcctacgaggatgtgctggtt
gtgactatccagtaccgactaggaatgttcggcttcttcaagtgatgggacaagcacgcc
ctggggaactgggccttcatggaccaggtggctgccctgacctgggtccaggagaacatc
aagttctttggtggggatccacactacgtgaccatcttcggcgagtcagctggagccata
agtgtttccagtcttattctgagccccatggccaaaggcttattccacagagccatcatg
gagagtggagtggccatcatcccttacctgaaggcccctgattacgagaggaatgaggat
ttgcagatgattgccaaaatctgtggctgcagtgtgtcagactccgtggccttgctgcaa
tgcctacgagcaaaatcatccaaggaattgctgagcatcaatcaggaaactaaggctttc
actcgagtggttgatggctttttctttcctcatgagcctatagaactattgactcaaaaa
tcatttaagccagttccttctatcatcggcgtcaataaccatgagtgtggcttcctgctg
cctatgaaagagtttcctgaggtcctcaggggctccaacaaatccttagtcctgcagttg
atgcactcaattctgcacgttcctgtacagtatttataccttgtggctaatgaatatttc
cacaacaagcactctctaattgatatacgaaatcgctttctggatttacttggagatgtg
ttctttgtggtgcctgggctggtcacagctcaatatcacagagatgcaggtgcacctgtc
tatttctacgagtttcagcatcgcccccagtgcttaaaggacaggaagccggcttttgtc
aaagctgatcacacagatgaaatccgttttgtctttggaggtgccttcctgaagggcgac
attgtcatgtttgaaggagccacagaggaagagaaatggctgagcaggaagatgatgaga
tactgggctaactttgcccggagcggggatcctaatggggaaggcctgcctctgtggccg
gcctatggtcagaccgaggaatacctgcagctgaatttgaacttgagtgtgggacagagg
ctgaaggagctggagctagagttctggacagacaccattcccctggtgatgtcttcgtcc
agagtgctcctcgctcctctttcttcctttatcttcctttctctgttcctgcctttcttt
ttctctctggttccttga

DBGET integrated database retrieval system