KEGG   Sus scrofa (pig): 100310796Help
Entry
100310796         CDS       T01009                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
ssc  Sus scrofa (pig)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ssc03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ssc03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:ssc04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFRCKAVANGKVLPNDPIFLEPHEEMILCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
LENPEILRKTADDFLSRVALTDAHLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTSLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSPELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaatagtagccagaagcggcactggactttcgccagtgaggagcagctagcc
cggttgcgggccgacgccaaccgcaaattcagatgcaaagcagtggcgaatgggaaggtt
cttccaaatgacccaatctttcttgagcctcatgaagaaatgatactctgcaaatactat
gagaaaagattattggaattctgttcagtgtttaagccagcaatgccaaggtctgttgtg
ggtacggcttgtatgtatttcaagcgtttttatcttaataactcagttatggaatatcac
ccccggataataatgctcacttgtgcatttttggcctgcaaggtagatgaattcaatgta
tctagtccacaatttgttggaaatctgcgggagagtcctcttggacaagagaaagcactt
gaacagattttggaatatgaactgctccttatacaacagcttaatttccaccttattgtc
cacaatccttatagaccttttgagggctttctcattgatttaaagactcgatatcccatg
ttggagaatccagagattttgaggaagacagctgatgactttctcagtagagttgcattg
acggatgctcaccttttatacacaccttcccagattgccctgactgccattttatctagt
gcatccagagcaggaattactatggaaagttatttatcagaaagtctgatgctcaaagag
aacagaactagcctgtcacagttactagatattatgaaaagcatgagaaacttggtaaaa
aaatatgaaccacccagatctgaagaagttgctgttctgaaacagaagttggagagatgt
cactctcctgagcttgcacttaacgtaattaccaagaagaggaaaggttatgaagatgat
gattatgtctcaaagaaatccaaacatgaggaggaagaatggactgatgatgacctggta
gattccctgtaa

DBGET integrated database retrieval system