KEGG   Sus scrofa (pig): 100310796Help
Entry
100310796         CDS       T01009                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
ssc  Sus scrofa (pig)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100310796 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    100310796 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100310796 (CCNH)
Transcription machinery [BR:ssc03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100310796 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFRCKAVANGKVLPNDPIFLEPHEEMILCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
LENPEILRKTADDFLSRVALTDAHLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTSLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSPELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaatagtagccagaagcggcactggactttcgccagtgaggagcagctagcc
cggttgcgggccgacgccaaccgcaaattcagatgcaaagcagtggcgaatgggaaggtt
cttccaaatgacccaatctttcttgagcctcatgaagaaatgatactctgcaaatactat
gagaaaagattattggaattctgttcagtgtttaagccagcaatgccaaggtctgttgtg
ggtacggcttgtatgtatttcaagcgtttttatcttaataactcagttatggaatatcac
ccccggataataatgctcacttgtgcatttttggcctgcaaggtagatgaattcaatgta
tctagtccacaatttgttggaaatctgcgggagagtcctcttggacaagagaaagcactt
gaacagattttggaatatgaactgctccttatacaacagcttaatttccaccttattgtc
cacaatccttatagaccttttgagggctttctcattgatttaaagactcgatatcccatg
ttggagaatccagagattttgaggaagacagctgatgactttctcagtagagttgcattg
acggatgctcaccttttatacacaccttcccagattgccctgactgccattttatctagt
gcatccagagcaggaattactatggaaagttatttatcagaaagtctgatgctcaaagag
aacagaactagcctgtcacagttactagatattatgaaaagcatgagaaacttggtaaaa
aaatatgaaccacccagatctgaagaagttgctgttctgaaacagaagttggagagatgt
cactctcctgagcttgcacttaacgtaattaccaagaagaggaaaggttatgaagatgat
gattatgtctcaaagaaatccaaacatgaggaggaagaatggactgatgatgacctggta
gattccctgtaa

DBGET integrated database retrieval system