KEGG   Sus scrofa (pig): 100337667Help
Entry
100337667         CDS       T01009                                 

Gene name
MYST2, KAT7
Definition
K(lysine) acetyltransferase 7 (EC:2.3.1.48)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100337667 (MYST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVEFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLVKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagagagtgatggcacttcccggcgatctgcc
cgagtcacccgctcctcagcccggctaagccagagttcccaagattccagccctgttcga
aatttgcagtcttttggcactgaggagcctgcttattctaccaggagagtgacccgtagt
cagcagcaacctaccccagtgactccgaagaaatacccgcttcggcagactcggtcatct
ggctcagaaactgagcaagtggttgaattttcagatagagaaacgaaaaatacagctgat
catgatgaatctccacctcgaacgccaactggaaacgccccttcgtccgagtctgatata
gacatctccagccccaatgtgtcccatgatgagagcattgccaaggacatgtccctgaag
gattcgggcagtgatctctctcatcgccccaagcgccgacgcttccacgagagctacaat
ttcaacatgaagtgtcctaccccaggctgtaactctctaggacaccttacaggaaaacac
gagagacatttctccatatcaggatgcccgctctatcataacctctcagctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtcccacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggcaccaacagagaggcagttgcgatat
aaagaaaaggttgctgaactcagaaagaaaaggaattctggactgagcaaagaacagaaa
gagaaatatatggaacacaggcagacctatgggaacactcgggaacctctcttggaaaac
ctgactagcgagtatgacttggatcttttccgaagagcgcaagcccgggcttcagaggat
ttggtgaagttgaggctgcaaggccaaatcacagaggggagcaacatgattaaaacaatt
gcttttggtcgctacgagctagatacgtggtaccattctccctatcctgaagaatatgca
cgactgggacgtctctacatgtgtgaattctgtttaaaatacatgaagagtcaaacaata
ctgcgtcgacacatggctaagtgtgtttggaaacacccgcctggtgacgagatatatcgc
aaaggttcaatctctgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgcctgctggccaagctttttctggaccacaagacattatattatgatgtggaaccc
ttcctgttctatgttatgacagaggcggacaacactggttgtcacctgattggatatttt
tccaaggaaaagaattcattcctcaactacaatgtatcctgtatccttaccatgcctcag
tacatgagacagggctatggcaagatgctcattgatttcagttatttgctttccaaagtg
gaagaaaaagttggttccccagaacgtccgctttcagatctggggctcataagctatcgc
agttactggaaagaagtgcttcttcgttacctgcataatttccaaggcaaagagatttct
atcaaagaaattagccaggagacagctgtgaatcctgtggacattgtcagcactctgcaa
gcccttcagatgctcaaatattggaaaggaaaacacctagttttgaagagacaggacctg
atcgatgagtggatagccaaagaggccaaaagatccaactccaataaaaccatggatcca
agctgtttaaaatggaccccgcccaagggcacttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system