KEGG   Sus scrofa (pig): 100415928Help
Entry
100415928         CDS       T01009                                 

Definition
alpha-galactosidase A (EC:3.2.1.22)
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssc  Sus scrofa (pig)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100415928
  Lipid metabolism
   00561 Glycerolipid metabolism
    100415928
   00600 Sphingolipid metabolism
    100415928
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100415928
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100415928
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100415928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 433 aa AA seqDB search
MTATMKPVSRVRRLGYVLPFCFLAQVLWGVPGARALNNGLARTPTMGWLHWERFMCNVDC
QEDPDSCISEKLFRQIAELMASDGWKDAGYEYLCIDDCWMAPKRDSQGRLQADPKRFPGG
IRRLADYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAKTFAEWGVDLLKFDGCYCDS
IKHLADGYKQMSLALNRTGRSIVYSCEWPLYMQPFFKPNYTEIREYCNHWRNFADIYDSW
QSIKNILDWTSSNQEKIVPVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLLM
SNDLRHISPEAKALLQDKDVIAINQDPLGKQGHRLRKDNNFEVWERPLLNLAWAVAMVNL
QEIGGPRAYTISLTSLGQGLACNPDCLITQLLPVKRRLGFYEWTSSLKTQINPTGTVLLR
LERASSTASKSFL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacagctacgatgaagccggtgagcagggtccggcggctgggctacgtgctgccattt
tgcttcctggcccaggttctctggggcgtcccaggggcccgggccctgaacaacggcttg
gcgaggacccctaccatgggctggctgcactgggagcgcttcatgtgcaatgtggactgt
caagaagatccggattcctgtatcagtgagaagctcttccggcagatagctgagctcatg
gcctcagatggctggaaggatgcaggttatgagtacctatgcattgatgactgttggatg
gctcccaaaagggattcccaaggcagacttcaggcagaccctaaacgctttcctggtggg
atccgccgcctagccgattatgtccacagcaaaggactgaagctagggatttatgcagat
gttggaaataaaacctgtgctggcttccctggcagttttggttactatgacattgatgcc
aagacctttgctgagtggggagttgatctgctcaaattcgatggttgttactgtgacagt
ataaaacatttggcagacggttataagcaaatgtccttggccctgaacaggactggcaga
agcattgtgtattcctgtgagtggcccctttatatgcagcccttttttaagcccaattac
accgaaatccgagagtactgcaatcactggagaaattttgctgacatttatgattcctgg
caaagtataaagaatattttggactggacatcttctaaccaggagaaaattgttcctgtt
gcaggaccagggggttggaatgatccagatatgctggtgattggcaactttggcctcagc
tggaatcagcaggtaactcagatggccctctgggctatcatggcggctccattactcatg
tccaatgacctccgacacatcagccccgaagccaaagctcttcttcaggataaagatgta
atagccatcaaccaagaccccctgggcaagcaggggcaccggctcagaaaggacaacaac
tttgaagtgtgggaaaggcctctcttgaacttagcctgggctgtggctatggtaaacctg
caggagatcggtggccctcgtgcttataccatctctcttacttccctgggtcaaggacta
gcctgtaatcctgactgtctgatcacacaactcctccctgtgaagaggaggcttgggttt
tatgaatggacttcaagtttaaaaactcaaataaatcccacaggcactgttttgcttcgg
ctagaaagagcaagctcaactgcatcaaaaagcttcctttaa

DBGET integrated database retrieval system