KEGG   Sus scrofa (pig): 100415934Help
Entry
100415934         CDS       T01009                                 

Gene name
SPACA5
Definition
sperm acrosome associated 5 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 160 aa AA seqDB search
MKAWGSVVVTLTMLMAATVDAKIYERCELATKLEKAGLDGFKGYTTGDWLCMAHYESGFD
TSFVNHNPDGSSEYGIFQLNSAWWCDNGVTPTQNLCHMECHELLNRHILDDIMCAQQVVS
SQEGMNAWDSWSQHCSGHDLSEWLKGCHLNVKPDPKRIHS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctggggctctgtggtggtgaccctcaccatgctaatggctgccactgtggat
gccaagatttatgaacgctgtgagctggcaacgaagctggagaaggcgggcctcgatggc
ttcaagggctacaccactggagactggctgtgcatggcgcactatgagagtggctttgac
acctcctttgtgaaccacaatcctgatggcagcagtgaatatggcattttccaactgaac
tccgcctggtggtgtgacaatggtgttacacccacccagaacctctgtcacatggagtgt
catgaactgctcaaccgccatattcttgatgacatcatgtgtgcccagcaggtagtgtcc
tcacaggaaggtatgaatgcctgggattcttggagccagcactgttctggccatgactta
tctgaatggctcaaggggtgtcatttgaatgtaaaacctgaccccaaaagaattcattca
tga

DBGET integrated database retrieval system