KEGG   Sus scrofa (pig): 100499564Help
Entry
100499564         CDS       T01009                                 

Gene name
PDIA6, pdi-p5
Definition
protein disulfide isomerase family A, member 6 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100499564 (PDIA6)
Enzymes [BR:ssc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100499564 (PDIA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 440 aa AA seqDB search
MARLVLGLMSCTLFVAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQR
LTPEWKKVATALKDVVKVGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTG
EAIVDAALSALRQLVKDRLGGRGGGYSSGKQGRSEGSGKKDVIELTDDTFDKNVLDSEDV
WMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTI
KIFQKGESPVDYDGGRTRSDIVTRALDLFSDNAPPPELLEIISEDVAKKSCEEHQLCVVA
VLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQTELEHALGIGGFGYPAMA
AINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPAISTREPWDGKDGELP
VEDDIDLSDVELDDLEKDEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctcggctggtcctcggtctgatgagctgtaccctcttcgtagcagttaatggtctc
tattcatctagtgacgatgtcatcgaattaacgccgtcaaatttcaaccgagaagtcatc
caaagtgatagtttgtggctcgtagaattctatgctccttggtgtggccactgccaaagg
ttgacaccggagtggaagaaggtagcaactgcattaaaagatgtggtgaaggttggcgcg
gtcgacgcagacaagcatcagtccctgggcgggcagtacggcgtgcagggctttcccacc
atcaagatcttcggctccaacaaaaacagacccgaagattatcagggtggcaggacgggt
gaagccatcgtggacgccgctctcagcgctctgcgccagctcgtgaaggatcgcctgggg
ggccgcgggggtggctatagttctggaaaacaaggtagaagcgaaggttcgggtaagaag
gacgtgattgagctgacggatgacacctttgataagaacgttctcgacagcgaagatgtt
tggatggttgagttctatgctccttggtgtggacactgcaaaaatctagagccagagtgg
gccgcggcagccacggaggtgaaggagcagaccaagggcaaggtgaagctcgcggccgtg
gacgccaccgtgaaccaggtcctcgccagccggtacgggatcagaggatttcctaccatc
aagatctttcagaaaggcgagtcccccgtggattacgacgggggccggacgcggtccgac
atcgttacccgggctcttgatctgttttcggataacgccccgccccctgagctgctcgag
atcatcagcgaggacgtcgccaagaagtcgtgcgaggagcaccagctctgcgtggtggcc
gtgctgccgcatattctcgacacgggagctgcaggcagaaattcttacttggaagttctt
ctgaagctggcagacaagtacaaaaagaaaatgtgggggtggctgtggacagaggccgga
gcccagaccgaactggagcacgcgctgggcatcggaggctttggctaccctgccatggct
gccatcaacgcccgcaagatgaagtttgctctgctaaaaggatctttcagtgagcaaggc
attaacgagtttctcagggagctgtctttcgggcgcgggtccacggcgcccgtgggaggc
ggggcgttcccggccatcagcaccagggagccttgggacggcaaggatggcgagcttccc
gtggaagacgacatcgacctgagcgacgtggagctggacgacctggagaaggatgagttg
tga

DBGET integrated database retrieval system