KEGG   Sus scrofa (pig): 100502562Help
Entry
100502562         CDS       T01009                                 

Gene name
PCMT1, PCMT, PIMT
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 227 aa AA seqDB search
MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATIS
APHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGPSGKVIGIDHIKELVDDSI
NNVRKDDPMLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLI
LPVGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaaatccggcggcgccagccactcggagctaatccacaacctccgcaaaaat
ggaatcatcaaaacagataaagtatttgaagtaatgctggccacagaccgctcccactat
gcaaaatgtaacccttacatggactcaccacaatcaatagggttccaggcaacaatcagt
gctccacacatgcatgcgtatgcgctagaacttctatttgatcaattgcatgaaggagct
aaagctctcgatgtaggatctggaagtggaatccttactgcatgttttgcacgtatggtt
ggacctagtggaaaagtcataggaattgaccatattaaagaactagtagatgactcaata
aataatgtcagaaaggatgatccaatgcttttgtcttcagggagagtgcagctggttgtg
ggggatggaagaatgggatatgccgaagaagccccttatgatgctattcatgtaggagct
gcagcccctgttgtaccccaggcactaatagaccagttaaagcctggtggaagattgata
ttgccagttggtcctgcaggtggaaatcagatgttggagcagtatgacaagctgcaagat
ggcagtgtcaaaatgaaacctctgatgggagtgatatacgtgcctttaacagataaagaa
aagcagtggtccaggtggaagtga

DBGET integrated database retrieval system