KEGG   Sus scrofa (pig): 100505461Help
Entry
100505461         CDS       T01009                                 

Gene name
CHKB
Definition
(RefSeq) choline/ethanolamine kinase
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00564  Glycerophospholipid metabolism
ssc01100  Metabolic pathways
ssc05231  Choline metabolism in cancer
Module
ssc_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
ssc_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100505461 (CHKB)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100505461 (CHKB)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100505461 (CHKB)
    2.7.1.82  ethanolamine kinase
     100505461 (CHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 100505461
NCBI-ProteinID: NP_001193289
Ensembl: ENSSSCG00000027994
UniProt: D2D0E0
Position
5
AA seq 395 aa AA seqDB search
MAAEGTAVAGGGAVGGLLAKDSLLQSKCPDAAPSRRRGSARSRDAERRAYQWCREYLGGA
WRRVRPEELRVDPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES
VMFAILAERALGPQLYGVFPEGRLEQYIPSRPLKTHELREPVLSAAIATKMARFHGMEMP
FTKEPHWLFGTMERYLKQIQDLPPTGLPQMNLLEMYSLKEEMGSLRKLLDTTPSPVVFCH
NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKAQP
ADYPTRGQQLHFIRHYLAEVKKGETISQEEQRKLEADLLVEANRYALASHFFWGLWSILQ
ASMSTIEFGYLEYAQSRFQSYFQQKAQLTSLQPSS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaggggacagctgtggccggaggcggggctgtcggaggcctcctggccaag
gacagcttgctgcagtctaaatgccccgacgcggccccaagccggcggcgcggctccgcg
cggtcgcgagacgccgagcgccgagcctaccagtggtgccgggagtacttgggcggggcc
tggcgccgagtgcggccggaggagctgagggttgaccccgtgagcggaggcctcagtaac
ctgctcttccgctgctcgctgccggaccacctgcccagtgttggcgaggagccccgggag
gtgctgctgcggctgtatggggccatcctgcagggcgtggactccttggtccttgaaagt
gtgatgttcgccattcttgcagagcgggcgctgggcccccagctctacggagtctttccg
gagggccggctggaacagtacatcccaagccggccactgaagacccacgagcttcgagag
ccagtgttgtctgcagccattgccacgaagatggcccgtttccacggcatggagatgcct
ttcactaaggagcctcactggctatttgggactatggagcggtatttaaagcagatccag
gacctgccccccactggccttccccagatgaacctgctggagatgtacagcttgaaggaa
gaaatgggcagcctcaggaagttgctagacactaccccatcaccagtggtcttctgccac
aacgacatccaggaagggaacatcttattgctctcagagccggaaaatgccgacagcctc
atgctggttgatttcgagtatagcagttataactacaggggctttgacattgggaaccac
ttttgtgagtgggtttacgattatacgcacgaggagtggcctttctacaaagcgcagcct
gcagactaccccacccggggacagcagctccattttattcgccactacctggcggaggta
aagaaaggtgaaaccatctcccaggaggagcagaggaaactagaagcggatttgctggta
gaggctaatcggtacgctctggcatctcatttcttttggggtctctggtccattctccag
gcatccatgtccactatagaatttggctacttggagtatgcccagtctcggttccagtcc
tacttccagcagaaggcacagctgaccagcctccagccctcatcctga

DBGET integrated database retrieval system