KEGG   Sus scrofa (pig): 100511033Help
Entry
100511033         CDS       T01009                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100511033
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100511033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 379 aa AA seqDB search
GEGRGRTPALLGRGQARPRGGLGSHPTRSGSWRSSAPPCLRDSALKSQLPRPTQPPSRAG
VPGARLRPLAAQAESGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQ
DSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLAL
SNSDVIRQVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGA
CNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDT
DQGSNMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLI
PLVEKAKEKQNAKKAQETK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ggggaagggagaggcaggactccggccctcctcggccgggggcaggcgcgtccccggggc
gggctggggagccaccccacgcggtcagggtcgtggcggtcctcggccccgccgtgtctc
cgcgactcggcgctcaagtcccagctccctcgacccacgcagcccccgtcccgggcaggt
gtgcccggtgcccgactccggccccttgccgcgcaggcagagtcaggttgccgaggagcc
caagtagaagaaatatggagtttagagcctgagaattttgaaaaattaaagccagttcat
gggctgatttttcttttcaagtggcagcccggagaagaaccagcaggctctgtggttcag
gactcccgacttgacacgatattttttgccaagcaggtaattaataatgcttgtgctact
caagccatagtaagtgtgttattgaactgtacccatcaggatgtccatttaggagagaca
ttgtcagagtttaaggaattctcacaaagttttgatgcagctatgaaaggtttggccctg
agtaattcggatgtgattcgccaagtacacaacagtttcgccagacagcaaatgtttgaa
tttgatgcaaagacatcagcaaaagaagaagatgcttttcactttgtcagttacgttcct
gtgaatggaagactgtacgaattagatggattaagagaaggaccgatcgatttaggtgca
tgcaatcaagatgactggatcagcgcagtgaggccagtcatagaaaaaaggatacaaaag
tacagtgaaggtgaaattcgatttaacttaatggccattgtgtctgacaggaaaatgata
tatgaacagaagatagcagagttacaaagacagcttgctgaggaggaacccatggataca
gatcagggtagtaacatgttaagtgctattcagtcagaagttgccaaaaatcagatgctt
attgaagaagaagtacagaaattaaaaagatataagattgaaaacatcagaaggaagcat
aattatctgcctttcattatggaactgttaaagactttagcagaacaccagcagttaata
cctctcgtagaaaaggcaaaagaaaaacagaatgcgaagaaggcacaggaaaccaaatga

DBGET integrated database retrieval system