KEGG   Sus scrofa (pig): 100511372Help
Entry
100511372         CDS       T01009                                 

Gene name
HDAC3
Definition
histone deacetylase 3 (EC:3.5.1.98)
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
ssc  Sus scrofa (pig)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100511372 (HDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100511372 (HDAC3)
  Substance dependence
   05034 Alcoholism
    100511372 (HDAC3)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100511372 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagactgtggcctatttctacgaccccgacgtgggcaacttccactacggggct
gggcaccctatgaagccccatcgcttggccttgacccatagtctggtcctgcactacggt
ctttataagaagatgatcgtcttcaagccgtaccaggcctcccagcatgacatgtgccgc
ttccactctgaggactacattgacttcctgcagagagtcagtcccaccaacatgcaaggc
ttcaccaagagcctgaatgccttcaacgtgggcgatgactgcccagtgtttccggggctc
tttgagttctgctcccgttacacaggcgcatctctgcaaggagcaacgcagctgaacaac
aagatctgtgacattgccattaactgggctggtggcctgcaccatgccaagaagtttgag
gcttccggcttctgctacgtcaacgacattgtgatcggcatcctggagctgctcaagtac
cacccccgcgtgctctacattgacattgacatccaccacggggacggggttcaggaggcc
ttctacctcaccgaccgggtcatgacagtgtccttccacaaatacgggaactacttcttc
cccggcacaggtgacatgtacgaagtcggagccgagagcggccgctactactgcctcaat
gtgcccctgcgggatggcatcgatgaccagagttacaagcacctcttccagccagtcatc
aaccaggtggtggacttctaccaacccacgtgcattgtgctccagtgcggagccgactcc
ctgggctgtgatcgattgggctgcttcaacctcagcattcgaggtcacggcgagtgcgtc
gaatacgtcaagagcttcaacatccctctgctggtgctcgggggcggcggctacacggtc
cggaacgtcgcccgctgctggacgtatgagacatcactgctggtggaagaggccataagc
gaggagctcccctatagtgaatactttgagtactttgccccggacttcacgctccatcca
gacgtcagcacccgcattgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccacgcacccagcgtccagattcacgacgtg
cccgcagacctcctgacctacgacaggactgacgaggccgacgccgaggagaggggcccc
gaggagaattacagcaggccggaggcgcccaatgagttctatgacggagaccatgacaat
gacaaggaaagcgatgtggaaatttaa

DBGET integrated database retrieval system