KEGG   Sus scrofa (pig): 100511419Help
Entry
100511419         CDS       T01009                                 

Gene name
GALNT10
Definition
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)
Orthology
K00710  
polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ssc  Sus scrofa (pig)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:ssc00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 579 aa AA seqDB search
MPDLLRGWSERAAHHRPRAWQRRLCLCNEGSHIQQKNSFFLGDGQKLKDWHDKEAIRRDA
QRVGNGEQGKPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLEML
PNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELIAEIVLVDDFSDREHLKKPLEDYMALFP
NVRILRTKKREGLIRTRMLGASAATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCP
MIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAV
DRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGV
SLARNLKRVAEVWMDEYAEHIYQRRPEYRHLSAGDVAAQKKLRSSLNCKSFKWFMTKIAW
DLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLESCVRGRGEAAWNNMQVFT
FTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDQTMYHPVSGSCM
DCSESDHRIFMNTCNPSSPTQQWLFEHINSTVLEKFNSS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgccagacctgctcagaggctggagcgagcgagcggcccatcatcggccccgcgcctgg
caaaggagattatgcctctgcaacgagggctcacacattcaacaaaagaactcctttttc
ttgggagatgggcagaagctgaaggactggcacgacaaagaagccatcaggagggatgct
cagcgagtaggtaatggagaacaagggaaaccctaccccatgacagatgctgagagagtg
gatcaggcgtaccgagaaaatggatttaacatttatgtcagtgataaaatctccctgaat
cgctctctccctgatatccggcatccaaactgcaacagcaaacgttacctggagatgctc
cccaacaccagcatcatcatccccttccacaatgagggctggtcctccctcctccgcacc
gtgcacagcgtgctgaaccgctcgcccccggagctgatcgccgagattgtgctcgtcgat
gacttcagtgaccgagagcacctgaagaagccactcgaagactacatggccctgttcccc
aacgtgaggattctccgaaccaagaaacgggaagggctgataaggaccaggatgctgggg
gcctcagcagcaactggggatgtcatcacattcttggactcacactgtgaagccaatgtc
aactggctcccccccttgctcgaccgcatcgctcggaaccgcaagaccatcgtgtgcccg
atgattgatgtgattgaccacgatgactttcgatacgaaacacaggccggggatgccatg
cggggcgcctttgactgggagatgtactacaagcggatcccgatccccccggaactgcag
aaagctgaccccagcgacccgtttgagtctcctgtgatggccggtggactgtttgctgtg
gaccggaagtggttctgggagctgggcgggtacgacccaggcttggagatctggggcggg
gagcagtatgaaatctcattcaaggtgtggatgtgtggaggccgcatggaggacatcccc
tgctccagggtgggccatatctacaggaagtacgtgccctacaaggtgcccgctggagtc
agcctggcccggaacctgaagcgagtggcggaggtgtggatggacgagtacgcagaacac
atctaccagcgccggcccgagtaccgccacctctccgctggcgacgtggccgcccagaag
aagcttcgtagctcccttaactgcaagagtttcaagtggtttatgaccaagatcgcctgg
gacctgcccaaattctacccgccggtggagccccccgccgcagcctggggcgagatccgc
aatgtgggtaccggactgtgtgcagacacgaagcatggggccctgggctccccgctgagg
ctggagagctgcgtccggggccgtggggaggccgcctggaacaacatgcaggtcttcacc
ttcacctggagggaagacatccggcctggggacccccagcacaccaagaagttctgcttt
gacgccatctcccacaccagccccgtcactctctacgactgccacagcatgaagggcaac
cagctgtggaagtaccgcaaagaccagaccatgtaccaccccgtcagcggcagctgcatg
gactgcagtgaaagtgaccacaggatcttcatgaacacctgcaacccctcctctcccacc
cagcagtggctgtttgaacacatcaactcaacagtcttggaaaaattcaacagcagctga

DBGET integrated database retrieval system