KEGG   Sus scrofa (pig): 100511419Help
Entry
100511419         CDS       T01009                                 

Gene name
GALNT10
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 10 isoform X1
  KO
K00710  
polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ssc  Sus scrofa (pig)
Pathway
Mucin type O-glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100511419 (GALNT10)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100511419 (GALNT10)
Glycosyltransferases [BR:ssc01003]
 O-Glycan biosynthesis
  Mucin-type
   100511419 (GALNT10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
16
AA seq 603 aa AA seqDB search
MRRKEKRLLQAVALVLAALVLLPNVGLWALYRERQPDGTPGGAGAAVAPAAGQGSHIQQK
NSFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGKPYPMTDAERVDQAYRENGFNIYVSDK
ISLNRSLPDIRHPNCNSKRYLEMLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELIAEI
VLVDDFSDREHLKKPLEDYMALFPNVRILRTKKREGLIRTRMLGASAATGDVITFLDSHC
EANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIP
PELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRM
EDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEHIYQRRPEYRHLSAGDV
AAQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALG
SPLRLESCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHS
MKGNQLWKYRKDQTMYHPVSGSCMDCSESDHRIFMNTCNPSSPTQQWLFEHINSTVLEKF
NSS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggaaggagaagcggcttctgcaggcggtggcgctggtgctggcggccctggtc
cttctgcccaacgtggggctctgggcgctgtaccgcgagcggcagcccgacggcaccccc
gggggagccggggcagcggtggccccggcggctggacagggctcacacattcaacaaaag
aactcctttttcttgggagatgggcagaagctgaaggactggcacgacaaagaagccatc
aggagggatgctcagcgagtaggtaatggagaacaagggaaaccctaccccatgacagat
gctgagagagtggatcaggcgtaccgagaaaatggatttaacatttatgtcagtgataaa
atctccctgaatcgctctctccctgatatccggcatccaaactgcaacagcaaacgttac
ctggagatgctccccaacaccagcatcatcatccccttccacaatgagggctggtcctcc
ctcctccgcaccgtgcacagcgtgctgaaccgctcgcccccggagctgatcgccgagatt
gtgctcgtcgatgacttcagtgaccgagagcacctgaagaagccactcgaagactacatg
gccctgttccccaacgtgaggattctccgaaccaagaaacgggaagggctgataaggacc
aggatgctgggggcctcagcagcaactggggatgtcatcacattcttggactcacactgt
gaagccaatgtcaactggctcccccccttgctcgaccgcatcgctcggaaccgcaagacc
atcgtgtgcccgatgattgatgtgattgaccacgatgactttcgatacgaaacacaggcc
ggggatgccatgcggggcgcctttgactgggagatgtactacaagcggatcccgatcccc
ccggaactgcagaaagctgaccccagcgacccgtttgagtctcctgtgatggccggtgga
ctgtttgctgtggaccggaagtggttctgggagctgggcgggtacgacccaggcttggag
atctggggcggggagcagtatgaaatctcattcaaggtgtggatgtgtggaggccgcatg
gaggacatcccctgctccagggtgggccatatctacaggaagtacgtgccctacaaggtg
cccgctggagtcagcctggcccggaacctgaagcgagtggcggaggtgtggatggacgag
tacgcagaacacatctaccagcgccggcccgagtaccgccacctctccgctggcgacgtg
gccgcccagaagaagcttcgtagctcccttaactgcaagagtttcaagtggtttatgacc
aagatcgcctgggacctgcccaaattctacccgccggtggagccccccgccgcagcctgg
ggcgagatccgcaatgtgggtaccggactgtgtgcagacacgaagcatggggccctgggc
tccccgctgaggctggagagctgcgtccggggccgtggggaggccgcctggaacaacatg
caggtcttcaccttcacctggagggaagacatccggcctggggacccccagcacaccaag
aagttctgctttgacgccatctcccacaccagccccgtcactctctacgactgccacagc
atgaagggcaaccagctgtggaagtaccgcaaagaccagaccatgtaccaccccgtcagc
ggcagctgcatggactgcagtgaaagtgaccacaggatcttcatgaacacctgcaacccc
tcctctcccacccagcagtggctgtttgaacacatcaactcaacagtcttggaaaaattc
aacagcagctga

DBGET integrated database retrieval system