KEGG   Sus scrofa (pig): 100511469Help
Entry
100511469         CDS       T01009                                 

Gene name
USP12
Definition
ubiquitin specific peptidase 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 388 aa AA seqDB search
MVFTSRLFAGPAEHVESRFSSHVCGSDSCVCVRAGANASALEKEIGPEQFPVNEHYFGLV
NFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIP
PKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDTEN
NHSTPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNT
ETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPL
ELRLFNTSGDATNPDRMYDLVAVVVHCGSGPHRGHYIAIVKSHDFWLLFDDDIVEKIDAQ
AIEEFYGLTSDISKNSESGYILFYQSRD
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcacgtcgaggttgttcgcgggcccggccgagcacgtggagagccgcttctcc
agccatgtctgtggcagtgacagctgtgtctgcgtgcgtgcgggcgccaatgcctcggca
ttagagaaagagattggtccagaacagtttcctgtcaacgagcactattttgggttagtc
aatttcgggaacacctgctactgcaactccgtcctccaagcactttatttctgccgtccg
ttccgggagaaagttctcgcctacaagagccagccccggaagaaggagagcctcctcacg
tgcctggccgacctcttccacagcatcgccacgcagaagaagaaggttggggtcatcccg
cccaagaagttcataacgcggttacggaaggagaatgagctttttgacaactacatgcag
caagatgcccatgaattcttaaattacctgctaaatacgattgctgatattttacaagaa
gagcgaaagcaggaaaaacagaatggccgtttgcctaacggtaatattgacactgaaaat
aaccacagcacaccagacccaacgtgggttcatgagatttttcagggaacattgactaat
gaaaccagatgtcttacttgcgaaaccataagcagcaaagatgaagattttttagacctt
tctgttgacgtggaacaaaacacatcaattactcactgcttacggggttttagcaacacg
gaaactctatgcagtgaatacaaatattactgtgaagaatgtcgcagcaaacaggaagca
cacaaacggatgaaagttaaaaagctgcccatgattctggctctacatctgaaaaggttt
aagtatatggatcaacttcatcgatacacaaaactttcttaccgggtagtttttcctttg
gaacttcgtctatttaacacttcgggagacgcaaccaatcctgacagaatgtacgacctc
gtggccgtcgtggttcactgtgggagtggtccccatcgaggccattatattgcaatagtt
aagagtcacgatttttggttgttgtttgatgacgacattgtagaaaaaatagatgcacaa
gctattgaagaattctacgggttgacatccgatatctccaagaactcggagtctggctac
atccttttctaccagtctcgggactga

DBGET integrated database retrieval system